KEGG   Chlorobium phaeovibrioides: Cvib_0053Help
Entry
Cvib_0053         CDS       T00499                                 

Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cvib_0053
Enzymes [BR:pvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cvib_0053
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cvib_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
56398..57774
Genome map
AA seq 458 aa AA seqDB search
MKKKSDTAKKGYVFIAGAGPGDPELLTLKAVRALQDADVILYDDLVTSAIIDQFGGLKIY
TGKRKDSHHFEQDAINEEIARHALEGKTVVRLKGGDPFVFGRGGEEIDVLRKYGIDYEII
PGITAAHGASAYSEIPLTMRKVSSSVAFCTGHPVNKIQVPDADTLVYYMVASSVHEVLDA
VVKKGRPEETKVAIVQNATRYNQRVWTGTLGELRRKERAAYSPALLIIGENINQFIENNW
FSRKKKVLTGDADPRRYSSREWLVVNFPCRRVDEADRDRLEESISNVADYPVLFFPNRFA
VKYFFTYLMEFNRDVRHLANCTICTLGRPAATELQKYGIIADLALEPDSPSDIAIRLKER
AITGKKVLLPGSNLVDGYLMNELSALGNTVTPLSVYLHGQQEQEESIDLEFIDEIFFSSS
TCVKNFSSLYRTIPAGITVTTADSDTEREYCRLFGKRT
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaagagcgatacagcaaaaaaaggatatgtctttatagccggagccggcccc
ggcgaccctgaactcctcaccttgaaggctgtgcgggcgctgcaggatgccgatgtcatt
ctctatgacgatctggtgacaagcgcaatcatcgaccagttcggtggcctgaaaatctat
accggcaaacgcaaagacagccaccacttcgaacaggacgcaatcaacgaggagattgcc
cgccatgccctggaggggaaaacggttgtgaggctcaaagggggagaccccttcgtgttc
ggccgtggcggagaggagattgatgtgctcagaaagtatgggatagactacgaaatcatt
cccggcatcactgccgcacacggggcaagcgcatacagtgaaatacccctcaccatgcgc
aaggtctcctcgtccgttgctttctgcaccggccatcccgtcaacaagatacaggtgccc
gatgccgataccctggtttactacatggtggcctcttctgtgcacgaggtacttgatgcc
gttgtgaaaaaagggcgtcctgaagagaccaaggttgccattgtccagaatgccacccgt
tacaaccagagagtctggacgggaactctgggggagctccgcagaaaagagcgcgcggcc
tactctcccgccctcctcattatcggcgagaacatcaaccagttcattgaaaacaactgg
ttcagcaggaagaagaaagtgctgacgggagacgccgaccccaggcgctacagcagcagg
gaatggcttgttgtgaactttccctgccgccgggtggatgaggccgaccgcgacaggctc
gaggagagcatttccaatgttgccgactatccggtgctctttttcccgaacaggtttgcc
gtcaagtattttttcacctacctgatggagttcaaccgcgatgtgcgtcatctggcaaac
tgtaccatctgcacgctcggacggccggcagcaaccgaactccagaagtatggcattata
gccgatcttgcccttgagcccgacagcccttccgatattgccatccggctcaaagagcgc
gccatcaccggaaaaaaggtgctccttcccggttccaaccttgttgacggttacctgatg
aacgagctttcagctctgggcaacaccgttacaccgctgagcgtttatctgcacggtcag
caggaacaggaggagagtattgacctggagttcattgatgagattttcttctcttcctcc
acctgcgttaaaaatttcagttcgctctaccgaacgattcctgccggcatcactgttact
actgccgacagcgatacggaaagagagtattgccggctcttcggcaaaagaacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system