KEGG   Chlorobium phaeovibrioides: Cvib_0320Help
Entry
Cvib_0320         CDS       T00499                                 

Definition
hydrogenobyrinic acid a,c-diamide cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pvi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(324912..328715)
Genome map
AA seq 1267 aa AA seqDB search
MHDKIRIAAIVGMEQCNLRVWREVSEKISAHAELTQWTDQDLEHQNPEAAEAIQNADCVF
TTLIQFKGQADWLEEQLAKSKVKTIFAYESMPEVMQMTKVGNYVVSGDGGGMPDIVKKVA
KMLVKGRDEDALYGYMKLLKIMRTMLPLIPKKAKDFKNWMQVYTYWMHPTAENLAGMFNY
IMAEYFEVGVTAEKVQEVPTMGFYHPDAPEYLKDLHQYEKWLHKRDKASKQRHNIAMLFF
RKHLLQEKEYIDNTIRAIESRGLNPLPVFVMGVEGHVAAREWFTHANVDMLVNMMGFGFV
GGPAGATTPGASAAARDEILNKIDAPYVVAQPLFIQDINSWKKEGVVPLQSAMTYSLPEM
DGAVCPVVLGAIKDGRLHTVNDRLDRLSLIAKKFSDLRHTPNSEKKVAFVVYDYPPGMGK
KASAALLDVPKSIYSMLQKLKSEGYTVGELPESPEAMLEMLDRATDYEIQAHEPDCFSID
REVFNRITTDRERERIEGRWNGFPGDIVPVGTDKLFLGGIQFGNVFIGVQPRLGIQGDPM
RLLFDKENTPHHQYIAFYRWISREFGANAMVHVGMHGTVEWMPGLQLGVTGDCWPDALLG
EVPHFYIYPINNPSEANIAKRRGYATMISHNIPPLARAGLYKELPAFKEMLNDYRERGLE
KIVDGETEEAIIDKARQLNLTDDCPRVEGEAFQEYISRLYTYMMELEGRLISNSLHVFGA
TPQLETQVTTITEYLKVRGNERSLPSIILSAIGENGTYSDYATLATRARKGEAAAMKVRE
TVDGHTRDFIAETIFKNGNPATVFNTLTGGAKVTKEMAEAMNESLKEGIAMKNALEDNDN
EMKSFLHALSGGYIPSGPGGDLVRDGAGILPTGRNIHAIDPWRIPSELAFKRGQQIADSI
IARHVEENNGEYPESIAQVLWGLDTIKSKGEAVAVIIHLMGAEPAYDAQGKISHYSLIPL
EKLGRPRIDVLIQISSIFRDTFGVLVDHLDKLVKDAAKADETHEMNHIKKHVDIAMQNGA
DFEAATSRLFTQAPGSYGSQVEELVEDSAWETEQDLDDMFVKRTGFAYGGNRYGDQQTDI
LKGLLGTVDRVVQQVDSAEFGISDIDRYFSSSGALQLSARRRNPKGDNVKLNYVETFTAD
VKIDDADKALKVEFRTKLLNPKWFDTMLEQGHSGATEISNRFTYMLGWDAVTKGVDDWVY
KEAAETYAFDPKMRDRLMKANPKAFKNIVGRMLEASGRGMWNADPDMIDKLQEIYSDLED
RLEGIEV
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataaaatcagaatcgccgctattgtcgggatggagcaatgcaaccttcgggtc
tggcgtgaagtcagtgaaaagatttctgcacatgccgaactgacccaatggactgaccag
gacctcgaacatcagaaccccgaagccgccgaagcaatccagaacgcggactgcgttttc
accacccttatccagttcaaggggcaggccgactggcttgaggaacagcttgcgaagtcg
aaggtgaaaaccatttttgcctacgagtcgatgcccgaggtgatgcagatgacgaaggtg
ggcaactatgtggtttcaggtgacggtggcggcatgcccgacattgtcaagaaagtggcc
aaaatgctggtgaagggtcgcgacgaagatgccctctacggctacatgaagcttttgaag
atcatgcggacgatgctccccctgatccccaaaaaagccaaggatttcaagaactggatg
caggtctatacctactggatgcatccgacagcggaaaacctcgccgggatgttcaactac
atcatggctgagtactttgaagtgggcgtaacggccgagaaggtgcaggaggttcccacc
atgggcttctaccaccccgatgcacccgaatacctgaaagacctgcaccagtacgaaaag
tggctgcacaagcgcgacaaagcttcgaaacagcgccacaacattgcaatgctcttcttc
cgcaagcacctcttgcaggagaaggaatatatcgacaacaccatccgtgccattgaatcg
cggggactcaaccccctgccggtgttcgtgatgggtgttgagggccatgtagccgccagg
gagtggttcacccacgccaatgtggacatgctcgtcaacatgatgggattcgggtttgtg
ggcggtcctgccggcgccaccaccccgggagcttcggcggctgcgcgcgacgaaattctc
aacaaaattgacgcgccctatgttgtagcccagccgctcttcatccaggacatcaactca
tggaaaaaagagggcgttgttccgcttcagtcggccatgacctactcgctgcctgaaatg
gacggcgcggtatgcccggtggtgctcggcgccatcaaggacggccgcctgcacaccgtg
aacgaccgcctcgaccgcctttcgctcatcgccaaaaagttctcggacctccgccatacg
ccgaacagcgagaaaaaagtcgccttcgtggtctacgattatcctcccggaatgggaaag
aaagccagtgctgccctgcttgatgttcccaagagcatctacagcatgctccagaagctg
aaatcagagggctacactgtcggcgaactaccggaatcgcccgaagcaatgcttgaaatg
ctcgaccgcgcaaccgattatgaaattcaggcccatgagccggactgcttctcgatcgac
cgcgaggtgttcaaccgcatcaccacagaccgtgagcgcgaacgcattgaggggcgctgg
aatggattcccgggcgacatcgtccccgtcggtactgacaagctcttccttggcggcata
cagttcggcaatgtgttcattggcgtgcagccccgcctcggcatacagggcgatcccatg
cgcctgctcttcgacaaggagaacacaccgcaccaccagtacatcgctttctaccgctgg
atcagccgcgagttcggagccaatgccatggtacatgtgggcatgcacggcaccgttgaa
tggatgcccggcctgcagcttggcgtcaccggcgactgctggccagatgcgctgctcggc
gaggtcccgcatttctacatctaccccatcaacaacccgagcgaggcaaacatagccaag
cgccggggctatgcgaccatgatttcgcacaacatccccccgcttgcccgtgcaggcctc
tacaaggaactgccggcgttcaaggagatgctgaacgattaccgtgagcgcggtctggag
aagatagttgatggtgagaccgaagaggcaatcatcgacaaggcccgccagctcaacctt
accgacgactgcccgagggttgagggtgaagcgttccaggagtacatcagccgcctctac
acctacatgatggagcttgaaggccgtctgatatccaactcgctgcatgtgttcggcgct
accccgcagcttgagacccaggtgaccaccatcaccgagtacctgaaggtgcgcggcaat
gaaagatcacttccatcaatcattctgagtgccattggcgaaaacggaacctacagcgac
tacgcaacccttgccacccgcgcaaggaaaggcgaagcggctgccatgaaggttcgtgaa
accgttgacggccatacccgcgacttcattgccgagaccattttcaaaaatggtaatccg
gcaaccgtgttcaataccctgacagggggcgccaaagtgaccaaagagatggcagaagcc
atgaacgagtcgctgaaagagggcatagcgatgaagaacgcccttgaggacaacgacaac
gagatgaagagcttcctgcacgcactttcaggaggctacattccctcaggtcccggtggc
gatcttgtgcgcgatggcgcaggcattctgccgaccggccgcaacatccacgcaatcgac
ccatggcgcattccctcggaactggcgttcaaacgcggtcagcagattgccgacagcatc
atagcgcgccatgtggaagagaacaacggcgagtaccccgaaagcatcgcccaggttctc
tggggcctcgacaccatcaagagcaagggtgaagccgtcgcggtgatcatccacctgatg
ggagccgaaccggcatacgatgcacagggcaaaatcagccactacagcctcatcccgctt
gaaaaactcggacgcccacgcattgatgtgctcatccagatcagctccatcttccgcgac
accttcggcgtgctcgtcgaccatctcgacaagctggtgaaggatgccgccaaggctgat
gagacccatgagatgaaccacatcaagaaacatgtcgacatcgccatgcagaacggcgcc
gacttcgaagccgcaacttcacgcctcttcacccaggctcccggctcatatggttcacag
gtcgaagagctggtggaagactcggcatgggaaacggagcaggacctcgacgacatgttc
gtcaaacgcaccggattcgcatacggcggaaaccgctatggcgaccagcagaccgacatc
ctgaaaggcctgctcggcaccgtcgaccgggtggtgcagcaggtcgactccgcggagttc
ggcatttccgacatcgaccgctacttctcctcctccggagcgctgcagctctccgcacgc
cgccgcaacccgaagggcgacaatgtgaaactcaactatgtggagacctttacggcggac
gtgaagatcgacgacgccgacaaggcgctgaaggtggagttccgcaccaaactgctcaac
ccgaaatggttcgacaccatgctggagcagggccacagcggcgcaacggaaatcagcaac
cgcttcacctatatgctcggctgggatgccgttaccaaaggtgttgacgactgggtctac
aaagaggccgctgaaacctatgctttcgatccaaagatgcgcgaccgcctcatgaaagcc
aacccgaaagctttcaagaatattgtaggccgcatgcttgaggccagcggacgcggcatg
tggaacgcggatcccgacatgatcgacaaactccaggagatttacagcgatcttgaagac
cgccttgaaggcatcgaggtctga

DBGET integrated database retrieval system