KEGG   Chlorobium phaeovibrioides: Cvib_0548Help
Entry
Cvib_0548         CDS       T00499                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00240  Pyrimidine metabolism
pvi00250  Alanine, aspartate and glutamate metabolism
pvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cvib_0548
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cvib_0548
Enzymes [BR:pvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cvib_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABP36570
UniProt: A4SDL1
Position
complement(632374..633306)
Genome map
AA seq 310 aa AA seqDB search
MNHLTGLSRLSADSITGLLDTAAGFKQTLRSPNASFSPTLKNRRIALVFFENSTRTRFSF
EIAARNLGAGTLGFSAASSSVSKGETLSDTIKNLEAMQVDAFVLRHPSSGSAKLISRITP
KPVINAGDGSNEHPTQALLDMFTLREHFGSLKGLKVTIIGDVLHSRVARSNIYGLLRAGA
EVGLCGPVTLIPPDAEKLGVRLFTDLDRAIAWADTAIVLRLQLERASGTYLPSLEEYSRH
YGLTDERLERTGKHLLVLHPGPINREIEISNHVADRIQPPGYSKSMLLEQVTNGIAIRMA
VLETLLGGTP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatctcaccggactcagcagactcagtgcagattccatcaccggactgcttgat
acagcggccggattcaagcagacactccgctcccccaatgcatccttcagcccgacgctc
aagaacaggcgcatagctctggtttttttcgagaactcaacccgcacccgtttctccttt
gaaatagccgccagaaaccttggagcaggaacactcggcttcagcgctgcatcaagcagt
gtcagcaaaggtgaaaccctgagcgacacgataaaaaaccttgaggcaatgcaggtagac
gcgttcgtcctccgccacccctcatcgggcagcgcaaaactcatcagccgcatcaccccg
aaacctgtcatcaacgccggcgacggctcaaacgagcatcccacccaggccctgctcgac
atgttcactcttcgggagcacttcggctcactcaaagggctgaaggtcaccatcatcggc
gatgtgcttcacagcagggttgcccgctcaaacatttacggcctgctgagggccggtgcc
gaagtagggctctgcggcccggtaacactgatccccccggatgccgaaaaactcggagtc
cgtcttttcaccgacctcgaccgcgcaattgcctgggccgatacggccatcgtactccgc
ctgcagcttgaacgggccagcggaacctatctgccttcgcttgaagaatactcacgccat
tacggcctgaccgacgaacgccttgagagaaccggcaaacaccttctggttctgcatccc
ggccccatcaaccgtgaaatagaaatttcgaaccatgtagccgaccggatacagccgccc
ggctattccaaaagcatgctgctcgagcaggtcaccaacggcattgccatccgtatggcg
gtacttgagaccctgctcggcggaaccccttag

DBGET integrated database retrieval system