KEGG   Chlorobium phaeovibrioides: Cvib_0557Help
Entry
Cvib_0557         CDS       T00499                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_0557
   01230 Biosynthesis of amino acids
    Cvib_0557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_0557
  Energy metabolism
   00680 Methane metabolism
    Cvib_0557
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_0557
Enzymes [BR:pvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cvib_0557
Exosome [BR:pvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cvib_0557
  Exosomal proteins of melanoma cells
   Cvib_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
644737..645480
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNLDNRFTGWHDIDLTDKGRREASNAGKLLCEAGFEFDVAYVSVLKR
AIRTLWNVLDEMNLMWIPVIRNWRLNERHYGALQGLNKAETAQKYGDEQVLVWRRSYDTP
PPPLERTDERWPGSDRRYAALDADEVPLTECLKDTVARFLPFWHETIAPEISKGRNVLIV
AHGNSLRALVKYLDGISEEDIVGLNIPTGIPLVYELDDNLKPLKSYYLGDQEELKKAVDA
VAGQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacttgtattgttgcggcatggtgaaagtcagtggaacctggataaccggttt
accggatggcatgatattgatttgactgacaagggacgccgtgaagcctccaatgccggg
aaactgctttgcgaagcgggtttcgagtttgatgtggcctatgtttcggtactgaagcgg
gccatcaggaccctctggaatgtactggatgagatgaatctgatgtggattcccgtcatc
aggaactggaggctcaatgagcgccattacggtgcgcttcagggcctcaataaagctgaa
acagcccagaaatatggcgacgagcaggttcttgtgtggcgcagaagttatgatacccct
cctcctccgcttgagcgcaccgatgagcggtggccgggttccgaccgtcgctatgccgca
cttgacgccgatgaggttcctcttaccgagtgcctgaaggatacagttgcgcgctttctg
ccgttctggcatgagaccattgctcctgaaatcagcaaaggccgcaatgttcttattgtc
gcccatggaaactcacttcgcgcactggtcaaataccttgacggcatatccgaagaggat
atcgtcgggctgaatattcctaccggtatcccccttgtctatgaacttgacgataacctg
aagccgttgaaaagctattatctgggagaccaggaagagttgaaaaaggctgtagacgca
gtggccggacagggaaaagcctga

DBGET integrated database retrieval system