KEGG   Chlorobium phaeovibrioides: Cvib_0589Help
Entry
Cvib_0589         CDS       T00499                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cvib_0589
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_0589
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cvib_0589
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cvib_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
685152..685955
Genome map
AA seq 267 aa AA seqDB search
MTENRITALLRQDKKLLLAYYMPEFPVAGATLPVLEALQESGADIIELGIPFSDPVGDGP
VIQEAAHRSIANGVSLHRLLDIVGRARRGEGCRKITVPILLMGYCNPLIAYGGDCFLTDA
TEAGIDGLLLPDLPPEEAGEFLERAKAFSMTVVFLISPVTPPERIEMIDGMSTDFSYCLA
VNATTGTAKLSEGDTEASVDEYLKRVRRHTKKKFVVGFGIKDRERVEHMWRFADGAVVGT
ALLQNIASAGTPQEAARLAGEFWRTLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaacagaattaccgcactgctccgtcaggataaaaagcttctgcttgcctat
tatatgcccgagttccccgttgcgggcgcaacgcttccggtgcttgaagcacttcaggag
agcggggcggacatcatcgagctgggcatcccattttctgatccggtcggcgacgggccg
gtgatacaggaggcggcccacaggtcaatagccaacggggtgagtcttcaccggctgctt
gatattgttggccgggcacgcaggggagaggggtgcaggaaaataaccgttcccattctt
ctgatggggtactgcaacccgctcattgcctatggcggtgactgctttctcaccgatgcc
actgaagctggtattgacggactgcttctgcccgaccttccccccgaagaggccggtgag
ttcctggaacgggccaaagcgttcagtatgacggtggtgttcctgatttcacccgtcacc
ccaccggaacgaatcgaaatgattgatggcatgtccactgatttttcctactgtctggca
gtcaacgccacaacaggaaccgccaagctgtcggaaggcgacactgaagcttctgttgat
gaatacctgaaacgggttcgccggcacacgaaaaagaaatttgtagtcgggttcggcatc
aaagaccgcgaaagggtagagcatatgtggaggtttgccgatggagcagttgttggaacc
gcactcctgcagaacattgcttcggccggaacgcctcaggaggccgcccgtcttgccgga
gagttctggcgcacattgcgctga

DBGET integrated database retrieval system