KEGG   Chlorobium phaeovibrioides: Cvib_0589Help
Entry
Cvib_0589         CDS       T00499                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00260  Glycine, serine and threonine metabolism
pvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01130  Biosynthesis of antibiotics
pvi01230  Biosynthesis of amino acids
Module
pvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_0589
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cvib_0589
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cvib_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABP36611
UniProt: A4SDQ2
Position
685152..685955
Genome map
AA seq 267 aa AA seqDB search
MTENRITALLRQDKKLLLAYYMPEFPVAGATLPVLEALQESGADIIELGIPFSDPVGDGP
VIQEAAHRSIANGVSLHRLLDIVGRARRGEGCRKITVPILLMGYCNPLIAYGGDCFLTDA
TEAGIDGLLLPDLPPEEAGEFLERAKAFSMTVVFLISPVTPPERIEMIDGMSTDFSYCLA
VNATTGTAKLSEGDTEASVDEYLKRVRRHTKKKFVVGFGIKDRERVEHMWRFADGAVVGT
ALLQNIASAGTPQEAARLAGEFWRTLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaacagaattaccgcactgctccgtcaggataaaaagcttctgcttgcctat
tatatgcccgagttccccgttgcgggcgcaacgcttccggtgcttgaagcacttcaggag
agcggggcggacatcatcgagctgggcatcccattttctgatccggtcggcgacgggccg
gtgatacaggaggcggcccacaggtcaatagccaacggggtgagtcttcaccggctgctt
gatattgttggccgggcacgcaggggagaggggtgcaggaaaataaccgttcccattctt
ctgatggggtactgcaacccgctcattgcctatggcggtgactgctttctcaccgatgcc
actgaagctggtattgacggactgcttctgcccgaccttccccccgaagaggccggtgag
ttcctggaacgggccaaagcgttcagtatgacggtggtgttcctgatttcacccgtcacc
ccaccggaacgaatcgaaatgattgatggcatgtccactgatttttcctactgtctggca
gtcaacgccacaacaggaaccgccaagctgtcggaaggcgacactgaagcttctgttgat
gaatacctgaaacgggttcgccggcacacgaaaaagaaatttgtagtcgggttcggcatc
aaagaccgcgaaagggtagagcatatgtggaggtttgccgatggagcagttgttggaacc
gcactcctgcagaacattgcttcggccggaacgcctcaggaggccgcccgtcttgccgga
gagttctggcgcacattgcgctga

DBGET integrated database retrieval system