KEGG   Chlorobium phaeovibrioides: Cvib_0596Help
Entry
Cvib_0596         CDS       T00499                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cvib_0596 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Cvib_0596 (hisD)
Enzymes [BR:pvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Cvib_0596 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
693122..694453
Genome map
AA seq 443 aa AA seqDB search
MGNEPAPIESPNKKPVLKIFPFADNPDALMAHLSRTVSFDDTVQKAVDEILQAVRQRGDE
AVLDYTEKFQGFRPESMKVSPEAIRRAREEADPEFISTLKEAYGNILEFHRHEVEKSFFY
EGEGGVLLGQRVTPMQRALLYVPGGKAAYPSSVLMNAAPAQVAGVGEIAMTTPCDSTGEV
SSHILAAASVAGISSVYKLGGAQAIAAFAYGTQSIEKVDIITGPGNKFVALAKKEVFGHV
AIDSIAGPSEVVIIADADANPDYIVLDLFAQAEHDADASSVLITPSASLAERVAAIAGER
IGGMLRREVIEASLRQNGAIILVDSLDEAARVSDMLAPEHLELHVNHPWELLPSLHHAGA
IFMGSSSCETVGDYYAGPNHTLPTNGTARFFSPLSVRDFVKHTSIIAYSQQQLLRCGERI
ADFADREGLQAHAEAVRIRLAGK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgaaccggcccccatagagtcaccaaacaagaaacctgtgctgaaaattttc
ccttttgccgacaaccccgatgcgctgatggcgcacctctcccgtactgtctcttttgac
gacacggtacagaaggctgttgatgagattctccaggctgtgcgccagaggggagacgag
gcggttcttgattataccgagaagtttcagggcttcaggcccgaaagcatgaaggtatcg
cccgaagccatacggcgcgcccgggaggaggcggatccggaattcatcagcaccctcaag
gaagcctacggcaatattctggaatttcaccgccatgaggtggaaaagagtttcttctat
gaaggcgagggcggtgtgctgctcggccagcgggttaccccgatgcagcgggcactgctc
tatgtgcccggaggcaaagcggcctatccttcatcggttctgatgaatgccgctcctgcc
caggtagcgggagtgggcgagattgcaatgacaacgccctgcgacagcacaggagaggtc
agcagccatattcttgcagctgcttctgttgccggcatttcctccgtctacaaacttggc
ggagcgcaggccattgccgcatttgcatatgggacacagagcatcgaaaaggtcgacatc
attacaggccccggcaacaaattcgtggctctggcaaagaaagaggtgttcggtcatgtt
gcaatcgacagcattgccggtccctcagaggttgtcattattgctgatgccgatgccaac
cccgactatattgtgctcgacctgttcgcgcaggcggaacatgatgctgacgcctcttct
gttcttattacaccgtccgcttctcttgcagagcgcgtagccgccattgccggcgaacgg
ataggggggatgctccgccgggaggttattgaagcttcgcttcgccagaacggcgccatt
attcttgtcgactcccttgatgaagccgcacgggtctccgacatgcttgctcccgagcat
ctggagctgcatgtgaaccatccctgggagctgctcccctcactccatcatgccggagca
attttcatgggcagctcttcatgcgaaaccgtaggcgactactatgcagggcccaaccat
acccttcccaccaacggaacagcacgcttcttttcaccactctccgtgcgtgattttgtg
aagcacacctccattatcgcatattcacagcagcagctgcttcgatgcggggagcggata
gccgactttgccgatcgcgaagggcttcaggctcacgccgaggcagtcagaataaggctt
gcaggaaaatga

DBGET integrated database retrieval system