KEGG   Chlorobium phaeovibrioides: Cvib_0642Help
Entry
Cvib_0642         CDS       T00499                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cvib_0642
Enzymes [BR:pvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cvib_0642
Peptidases [BR:pvi01002]
 Cysteine Peptidases
  Family C44
   Cvib_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
745645..747144
Genome map
AA seq 499 aa AA seqDB search
MIKQYTPNQPSLYAPSGMVLYSDVAGEFPLYLYWPQDQSTLLYSTSITELLNDARVPKPL
KVSTEGLSFLLQIGVVPPPKTAYQDIYIVGIGDKAKVSSVNGKIDIQFSYEFPFLNAKRM
QADEMQPDEDLILQMLAEATISRIDESKPSFLFHSAGKDSNSIALALAEAGWQDKVTLIT
HKSKGQADETEISAQIAKQLGFKHQILHEVDQLQAEHKHAINDYFVNAPFPCTDHVTLAY
PLYAHQVPELKGANIIDGGGNDVFIGHIPSRSEYKRSEASKYLKHIRVVSRHFPSESLFY
VAGRTRAEWAGLSGLSFSDMKRILPNALDPSDFLLSTDSNQNYLDFRASIRGTIISTEIF
TRKVRNFADAINANIILPWASQQVAEYFSKMPEQHLFDRKTLKNKLILRKILKDRIGLDS
DQIGKMGYSYDSRSIVLQNWDWMLKEIQHCLLWQQPGLLEVVSRMKNRMNVTGWGAGAAG
RLIYRIYLISAWHNENQYL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaatacacccccaaccaaccaagcctttatgccccttcgggtatggtgctt
tattccgatgtagcgggcgagtttcctctgtatctttattggccgcaggatcaatcgact
ttgttgtattctacctcgattaccgagttattaaacgatgcgcgtgtgccgaagccgtta
aaagttagcacagaaggcctgtcgtttttattgcaaattggggtagtgccaccgccgaaa
acagcttatcaagatatttatattgttggcattggtgataaggccaaggtgtcctcggtg
aatggaaaaatcgacattcagtttagctacgaattcccgtttttaaacgccaagcgaatg
caggccgatgaaatgcagccggatgaagatttgattttacaaatgctcgccgaggcgacc
atcagccgcattgacgaatcaaagccgagttttctattccacagcgcaggcaaagacagc
aacagcatcgcattggcgttagcggaagcgggttggcaggataaggtcaccttgattacc
cataaatccaaaggccaggcggatgaaactgaaatcagcgcccaaatcgccaaacaactg
ggttttaaacatcagatattgcacgaagtcgatcaactgcaagctgaacacaaacacgcc
attaacgactattttgttaatgcgcctttcccttgcaccgaccatgtcaccttggcctat
ccgctctatgcccaccaagtgcccgaactcaaaggcgcgaatattattgatggcgggggt
aatgatgtattcattggtcacattccaagtcgttcagaatataaacgttcggaagcatca
aaataccttaagcatattcgggtagtgtcaagacattttccgtcggaaagtttgttttat
gtcgctggtcgcacacgagcagaatgggcaggattatcaggactttccttttcagatatg
aagagaattttacccaacgcccttgatccatctgattttttgctttcaacagatagtaat
cagaattatctggattttagagcctcgattcgcgggacgattattagcacagaaattttt
acaagaaaagttcgaaattttgccgatgcaattaacgcaaacattattttaccttgggcc
agtcaacaggttgccgaatacttctccaaaatgcccgaacaacacctgttcgaccgcaaa
accctaaagaacaaactcatcctccgcaaaatcctcaaagaccgcattgggcttgattca
gatcagattgggaagatggggtatagttacgattcacgctcaatcgtcttgcaaaactgg
gactggatgctgaaagaaatacagcattgtctcctctggcaacaaccaggtttgttggaa
gtggtctcccgtatgaagaaccgtatgaacgtcaccggctggggcgctggcgcagcaggg
aggttgatatatcgaatatatttgatttcagcatggcataacgagaatcagtatttgtga

DBGET integrated database retrieval system