KEGG   Chlorobium phaeovibrioides: Cvib_0867Help
Entry
Cvib_0867         CDS       T00499                                 

Definition
(GenBank) ATP citrate lyase subunit 1
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00020  Citrate cycle (TCA cycle)
pvi00720  Carbon fixation pathways in prokaryotes
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01120  Microbial metabolism in diverse environments
pvi01130  Biosynthesis of antibiotics
pvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cvib_0867
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cvib_0867
Enzymes [BR:pvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cvib_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2 ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABP36882
UniProt: A4SEH3
Position
complement(973159..974355)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPERLLQLGEANKWLRDSKLVVKAHEAIGGRFK
LGLVKIDLNLEEAYEAAKEMLGRQIGTAEIRQVIVAEMLEHDAEYYVSIAGNRDGAELLL
SNKGGIDIEDNWDTVKRLQIPLDVTPTIEDLTKIASSAGFEGEVAERVAKIASRLILCFD
NEDAQSIEINPLVIRNSDMRFAALDAVMNVDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPSDWAV
EALTETICQLPNIKHIIVGGAIANFTDVKATFSGIINGFRASKANGYLEGVKIWVRRGGP
NENQGLAAIKKLADEGFDIHVYDRTMPMTDIVDLALKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggcctgccatgaaactgttcaacaagtggggcattcccgtg
cctaactatgttgttatcatggatcccgaacgccttttgcagctcggagaagctaataaa
tggctcagagattcaaaacttgtcgttaaggctcatgaagccattggtggtcgtttcaag
cttggtcttgtcaaaattgacctgaatcttgaagaggcgtatgaggcagcaaaggagatg
cttggccgtcagatcggtactgccgaaatccgtcaggtgattgtagctgaaatgcttgag
catgatgctgaatattatgtctccattgccggcaaccgcgacggtgcagagcttctttta
tccaataaaggcggcattgatattgaagataattgggatacagtcaaaaggcttcagatt
cctctcgatgttaccccgaccattgaggaccttaccaaaattgcttcaagtgcgggattt
gaaggcgaggtggccgaacgggttgccaaaatcgcctctcgtctgattctctgctttgac
aatgaagatgcccagtcaattgaaatcaatccgctggtcatcagaaacagtgatatgcgt
tttgctgcgcttgacgccgtcatgaatgttgactgggatgcccgtttccgccatgcagac
tgggatttcaagcctgtctcggaaatcggccggccgtttactgaagccgagcagcagatc
atggaaatcgatgcgcgcatcaagggttcagtcaagtttgttgaagttcccggtggcgaa
attgccctgcttactgcaggcggtggtgcttccgtattctattcagatgctgttgttgcc
cgtggcggcacaattgcaaattatgccgaatattcaggtgatccttccgactgggctgtt
gaagcacttacagaaaccatctgccagctccccaacatcaagcatatcattgtaggtggt
gccattgcaaacttcaccgatgtgaaggcgaccttcagcggcatcatcaacggattccgt
gcaagcaaggcgaacggctaccttgagggagtgaagatctgggtaaggcgtggtggaccg
aatgagaaccagggtcttgcggctatcaaaaagctcgcagacgaagggttcgacattcat
gtctacgatcgcaccatgccgatgaccgatattgttgaccttgctctcaaagcataa

DBGET integrated database retrieval system