KEGG   Chlorobium phaeovibrioides: Cvib_0867Help
Entry
Cvib_0867         CDS       T00499                                 

Definition
ATP citrate lyase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_0867
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cvib_0867
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cvib_0867
Enzymes [BR:pvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cvib_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(973159..974355)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPERLLQLGEANKWLRDSKLVVKAHEAIGGRFK
LGLVKIDLNLEEAYEAAKEMLGRQIGTAEIRQVIVAEMLEHDAEYYVSIAGNRDGAELLL
SNKGGIDIEDNWDTVKRLQIPLDVTPTIEDLTKIASSAGFEGEVAERVAKIASRLILCFD
NEDAQSIEINPLVIRNSDMRFAALDAVMNVDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPSDWAV
EALTETICQLPNIKHIIVGGAIANFTDVKATFSGIINGFRASKANGYLEGVKIWVRRGGP
NENQGLAAIKKLADEGFDIHVYDRTMPMTDIVDLALKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggcctgccatgaaactgttcaacaagtggggcattcccgtg
cctaactatgttgttatcatggatcccgaacgccttttgcagctcggagaagctaataaa
tggctcagagattcaaaacttgtcgttaaggctcatgaagccattggtggtcgtttcaag
cttggtcttgtcaaaattgacctgaatcttgaagaggcgtatgaggcagcaaaggagatg
cttggccgtcagatcggtactgccgaaatccgtcaggtgattgtagctgaaatgcttgag
catgatgctgaatattatgtctccattgccggcaaccgcgacggtgcagagcttctttta
tccaataaaggcggcattgatattgaagataattgggatacagtcaaaaggcttcagatt
cctctcgatgttaccccgaccattgaggaccttaccaaaattgcttcaagtgcgggattt
gaaggcgaggtggccgaacgggttgccaaaatcgcctctcgtctgattctctgctttgac
aatgaagatgcccagtcaattgaaatcaatccgctggtcatcagaaacagtgatatgcgt
tttgctgcgcttgacgccgtcatgaatgttgactgggatgcccgtttccgccatgcagac
tgggatttcaagcctgtctcggaaatcggccggccgtttactgaagccgagcagcagatc
atggaaatcgatgcgcgcatcaagggttcagtcaagtttgttgaagttcccggtggcgaa
attgccctgcttactgcaggcggtggtgcttccgtattctattcagatgctgttgttgcc
cgtggcggcacaattgcaaattatgccgaatattcaggtgatccttccgactgggctgtt
gaagcacttacagaaaccatctgccagctccccaacatcaagcatatcattgtaggtggt
gccattgcaaacttcaccgatgtgaaggcgaccttcagcggcatcatcaacggattccgt
gcaagcaaggcgaacggctaccttgagggagtgaagatctgggtaaggcgtggtggaccg
aatgagaaccagggtcttgcggctatcaaaaagctcgcagacgaagggttcgacattcat
gtctacgatcgcaccatgccgatgaccgatattgttgaccttgctctcaaagcataa

DBGET integrated database retrieval system