KEGG   Chlorobium phaeovibrioides: Cvib_0955Help
Entry
Cvib_0955         CDS       T00499                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cvib_0955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_0955
  Lipid metabolism
   00071 Fatty acid degradation
    Cvib_0955
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cvib_0955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cvib_0955
   00626 Naphthalene degradation
    Cvib_0955
Enzymes [BR:pvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cvib_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077509..1078696
Genome map
AA seq 395 aa AA seqDB search
MHFEYQNPTRIVFGKGTLSKLGEVVREYGKKALVVTGGGSVKRNGTFERAVRSLNEAGVA
VAQCAGVEPNPRIATVERGADTARREGCDVVVALGGGSVMDAAKVMAAAVFYEGDPWNMM
AHGQPDRRLPESALPLITVPTLAATGSEMNSGAVITDEKSTLKSVVSARCLYPKVAVVDP
ELTLSVPKDQTANGICDLITHVTESYFNGIDGTPVQDRFAEGVILTAMEWGPEAIADGSN
IQAREQVQWASLVALNGWVQAGTASPFPVHMIEHSLSAHHDIAHGAGLSAINPSWMRFAA
RTRPDRFAGFAHRIFSIPLNGPEDSSAAMEGINRFEAFLASIGCPTSLGEMKIGDALIEQ
YAQDTLQVIHDAEGRLPGRPPMSAEDIVEVLRKAL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgaataccagaacccgacacgcatagtctttggtaaaggaaccctctcaaaa
ctcggtgaagtggttcgtgaatacggaaagaaggcccttgtggttaccggtggcggcagc
gtgaaacgcaacggcacctttgagcgcgcagtgcgcagtctcaacgaggccggcgtggca
gttgcccaatgcgccggcgtggaaccgaacccgcggattgcaacggttgagcgcggagcc
gatacggcccgcagggaagggtgtgatgtggtcgttgcccttggaggcggcagcgtcatg
gacgcagccaaggttatggcagcagctgtattctacgaaggggatccctggaacatgatg
gctcacggccagcccgaccgacggctgcctgaaagcgcccttcccctcatcaccgtgcca
acccttgcggcaacaggctctgaaatgaactcgggagccgtcatcaccgatgaaaagagc
accctcaagtcagtggtatcggccagatgcctttatccaaaagttgccgtagtagatccg
gaactgaccctgagcgtacccaaagaccagacagcaaacggcatatgcgacctgatcacc
catgtgacggaatcatacttcaacgggattgatggcacacctgtgcaggaccggtttgcc
gaaggggtcatcctcaccgcaatggagtggggaccggaagcaatagcagatggcagcaac
atccaggcacgcgaacaggtgcaatgggcatcgctggtggcactcaacggatgggtgcag
gccggtacggcatccccctttcctgtgcacatgatcgaacactcgctatccgcccaccac
gacatcgcccacggcgccggactctcagccatcaacccttcatggatgcgctttgcagcc
cgcacccgtcccgaccgatttgccgggttcgcacatcgcatcttctcaatccccctgaac
ggtcctgaagactcttcagcagcaatggaaggcataaaccgcttcgaggccttccttgcc
tcaatcggctgccccaccagcctgggtgaaatgaagatcggggacgcactgatagagcag
tatgcgcaggacacgctgcaggtaatccacgacgctgaaggccgccttcccggccggccg
ccgatgagcgcggaggacattgtggaagtgctcaggaaagcactctga

DBGET integrated database retrieval system