KEGG   Chlorobium phaeovibrioides: Cvib_1033Help
Entry
Cvib_1033         CDS       T00499                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1163964..1164578)
Genome map
AA seq 204 aa AA seqDB search
MRYTSAAIEALIDAFAKLPGVGRKTARRLAMHVLQQPRLEAERLASALLDAKDLVVRCSI
CQNVTDRDADPCRICTGQGRDQSVICVVESPVDVLAFEKTAHYKGLYHVLHGVISPLDGI
GPDDINIRELLQRLQPEEGGEVREIVLALNPTVEGETTSLYLSRLIAPLGIMVTKIARGI
PVGAELEFIDEATLSRAMEGRTTF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatacttcggccgcgattgaagcccttattgatgcgtttgccaagcttcccggt
gtcggtcgcaaaacggcacggcggcttgcaatgcatgtgctgcagcagccacggctggag
gccgagcggcttgcttctgcgctgcttgatgcaaaagaccttgttgtccggtgttcgata
tgccagaatgtgactgacagagatgccgatccctgccgaatatgcaccggacagggccgc
gaccagagtgtgatatgcgttgtcgagtctccggttgatgttcttgcttttgaaaaaacc
gctcactacaaagggctctaccatgttctgcatggggtgatttccccgcttgacggcatt
ggccctgacgacatcaacatccgtgaactgctccagcgtcttcagccagaagagggcggg
gaggtgagggagattgttcttgcgctcaatccgacggttgagggggaaacgacatcgctc
tatctttcacggctcattgctccccttggcatcatggtgacaaaaatagcccgtggaatc
cccgttggtgcagaacttgagtttattgacgaggcgaccctttcgcgggccatggagggt
cgcacgactttctga

DBGET integrated database retrieval system