KEGG   Chlorobium phaeovibrioides: Cvib_1082Help
Entry
Cvib_1082         CDS       T00499                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pvi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1224390..1225061
Genome map
AA seq 223 aa AA seqDB search
MKQEKTVSATLVNNPALTGRGTCCDDDECLNDPAQLPAEIMESMSESVYTLLEGVGEDPE
REGLLKTPERVARSLAFLTRGYRQDPEEMLKKAVFTESYDEMVLVKDIDIFSMCEHHMLP
FFGKAHVAYIPDGKIVGLSKLARVVEVFARRLQVQERLTQQIRDAIQDVLHPKGVGVVIE
AKHMCMVMRGVEKLNSVTTTSAMSGEFISSESTRGEFLRLIRP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggaaaaaacagtgtcagctaccttggtgaataacccggcacttacgggacgc
ggcacatgctgtgatgacgacgagtgcctgaacgacccggcacaacttccagcagagata
atggagtcaatgtcagaatctgtctacacactccttgaaggggttggagaggatccggag
cgcgaagggctgctgaaaacgcccgagcgggtagcccgttcacttgcattcctgacaaga
ggataccgtcaggatcctgaagagatgctgaaaaaagctgtttttacagaatcctatgat
gaaatggttctggtgaaggacattgacattttttcaatgtgcgagcatcacatgctccct
ttcttcggcaaggcacatgttgcatacattcctgatggaaagatagtggggctgtcaaaa
ctggcacgggtggttgaggtgtttgcacgccgccttcaggtgcaggaacgcctgacccag
cagattcgtgatgcaatacaggatgtgctgcacccgaaaggtgtgggagttgtcattgag
gcgaagcacatgtgcatggtgatgcggggcgttgagaagctcaactctgtcacaacaaca
tctgcaatgtcgggcgagttcatctcctcggaatcaacgagaggagaatttctgaggctg
atacgcccctga

DBGET integrated database retrieval system