KEGG   Chlorobium phaeovibrioides: Cvib_1174Help
Entry
Cvib_1174         CDS       T00499                                 

Definition
2-isopropylmalate synthase (EC:2.3.3.13)
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Cvib_1174
   01230 Biosynthesis of amino acids
    Cvib_1174
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cvib_1174
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Cvib_1174
Enzymes [BR:pvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     Cvib_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1320616..1322184
Genome map
AA seq 522 aa AA seqDB search
MKENILVFDTTLRDGEQSPGASLNVQEKVEIARQLEKLGVDIIEAGFPASSPLQLEAVQR
ISDESGVVIAALSRAVENDIKASWTALKGAKKPRIHTFISTSDIHIAGKFAGDRYGRTLE
EKRRTILKMAVDAVAFAKTFTSDIEFSAEDAGRTDPGYLAEITEAVISAGATTVNIPDTT
GYTWPSEFGRKIADLISRVPNSGNAIISVHCHNDLGLAVANSLSALENGARQVECSINGI
GERAGNASLEEIVMALKVRSDLHNFQTGIVTEEIYRTSRMVSGFTGIIVQPNKAIVGENA
FSHESGIHQDGMLKNRQTYEVMTPESVGVPKTSIVLGRHSGKHGLKARLEALGYTLADEE
LESVYRRFMEIADKKKEVYDDDLRVLMGDELGKPSTAFVLDYLHINSGTASIPTATVRIR
HREKVFEESATGDGPIDACFRAIERALGIESMVSTYSVRSATAGREALGEALVRISDGSV
SFNGRGISTDIIEASARAYIQALGLRLEHFENNTPETIDHGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaaacatcctggtatttgacacaaccctccgtgatggtgaacagtcgcccggt
gcatcccttaatgtccaggaaaaggttgaaatagcccgtcagctggaaaaactcggtgtc
gacatcatcgaggccggcttccccgcttcctcccctctccagcttgaagcagtacagaga
atcagcgacgagtcgggtgtggtaatagccgcattgtcgagagccgttgaaaacgacatc
aaggcttcatggacggcgcttaagggagcgaaaaagccgcgtatccacaccttcatcagc
acctccgacatacacattgcaggcaaatttgccggcgaccggtatggccgtacgcttgaa
gaaaaacgacggaccattcttaaaatggccgttgatgcggttgcctttgcaaaaaccttc
acctccgacattgagttttcagctgaagatgccggccggaccgatcccggatatcttgct
gaaataaccgaagcggttatttcagccggcgccacaacggtcaacatccccgacacaaca
ggatacacctggccctcggagttcggccgcaaaattgccgacctcataagccgcgttccc
aattccgggaatgccatcatcagcgtccactgccacaacgaccttggccttgcggttgcc
aactccctcagcgctcttgagaacggtgcacggcaggtggagtgttcaatcaacggcatc
ggggaacgggcgggcaatgcttcgcttgaggagattgtcatggccttgaaagtgcgcagt
gacctgcataattttcagaccggcattgttaccgaagagatttacaggaccagccgtatg
gtatcgggctttacgggaatcatcgtccagccgaacaaggcgattgtgggagaaaacgct
ttttcacatgaatccggaatccatcaggacggcatgctgaaaaaccgtcagacttacgag
gtcatgacccccgaatcggtcggcgttccaaaaaccagtattgtactcggtcgccattcc
gggaagcacggcctgaaggcccgccttgaagcccttgggtacacccttgctgacgaggaa
cttgaatcggtctatcgccgcttcatggagatagctgacaagaaaaaagaggtgtatgat
gatgacctcagggtactgatgggcgatgaactcggaaaaccctcaaccgcttttgttctc
gactacctgcatatcaacagcggaaccgcgtccatacctaccgccaccgtccgcatccgg
caccgcgagaaggtctttgaagagtcagccacgggtgacggccccattgatgcctgcttc
agggcgattgagagagctcttggcatagagtccatggtctcaacctactcggtgcgttca
gcaaccgcgggacgcgaggcgctcggagaggctctggtaagaatcagcgacgggagcgtc
tccttcaacggaaggggaatctctacagacatcatagaggcaagcgcccgggcctacatt
caggctctgggtcttcgactcgaacattttgaaaacaacacacctgaaacaatcgatcac
ggggtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system