KEGG   Chlorobium phaeovibrioides: Cvib_1272Help
Entry
Cvib_1272         CDS       T00499                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cvib_1272
Enzymes [BR:pvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cvib_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1422662..1424851)
Genome map
AA seq 729 aa AA seqDB search
MHREEANGAGDERLSGVVDRVSFFSPESGFAVLRLSSGADEAGMTVVGCIASVSPGQHIE
AVGRWQNDRNWGMQFRASTLSVVAPRSHEGMENYLASGMLKGVGPHLASVMMGAWGIDVF
TIIEAQPERLLELPGIGPKKQRQIVESWQEHKAVRDIMIFLQSHGVGTARALKIYKVYGA
DAVAVVSRDPYRLTRDISGIGFRTADAIALSIGIARDSPLRARAGISWVLQELSSRGHCR
VPETMLLDSARQLLQMREDILQEALKSELTVGHVIAEGEGEDRHLYLESLWKAEQGVAEG
IKRIASGKLPWGRIDVDRSVREAEERSRLELSPSQREAVRLALTSKLLVITGGPGVGKTT
IIRTLLSIPEVFGLSVLLCAPTGRAAKRLGEATGREGRTIHRMLEFDPYTYDFKRCSSNP
LNADIIIVDEASMIDVVLMNRLLSAISSKAAVVLAGDVDQLPPVGPGAVLADVISSEAVP
VVRLTEIFRQAAQSMIIQNAHRINRGEGLLRHEGPELTDFYFVSASGPEEIRRKLLSVVA
QRIPERFGLDPLEGIQVLTPMNKGPLGSQSLNTLLQERLNGGGGKRVERFAVTYGRGDKV
IQTINNYEKEVFNGDIGIISSIDDDDREMQVLFDGREVRYLFSELDEMAPAWAITIHKSQ
GSEYPAVVIPLSMLHYPMLERNLIYTAVTRGRKLVMVIGEEQALATAIARCTSKGRLTGL
AAALRLPIG
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgagaggaagcgaacggggcaggggatgaacggctcagcggagttgttgacagg
gtctcttttttcagccctgaaagcggctttgccgtgcttcgcctctcttccggagcggac
gaggccgggatgactgttgtgggctgcattgcctccgtttcaccgggtcagcacatagag
gctgtcggccgatggcagaatgacaggaactggggtatgcagtttcgtgcctctactctt
tcggttgtggctcccaggagccatgaggggatggagaactatcttgcttccggcatgctg
aagggggtggggccgcatctggcttctgtcatgatgggtgcctgggggatcgatgttttt
accatcattgaggctcagccggaacggctgcttgagcttcccggcatagggccgaagaag
cagcggcagattgtggagtcgtggcaggagcacaaggcggtgcgcgacatcatgatattc
ctccagtcgcacggggttggaaccgcaagagcactgaaaatctataaagtatacggtgca
gatgccgtggcggtggtcagccgcgacccctaccggcttacccgcgacatttcgggcatt
gggttccgcacggccgacgccattgccctaagcatcggtattgcccgggactctcccctt
cgggcccgggccggcatcagctgggtgctgcaggaactttcctccaggggccactgccgg
gttcccgaaaccatgctgcttgattcagcccgccagctcctccagatgcgtgaggatatc
ctgcaggaggctcttaagagtgaacttactgtggggcatgtcattgctgaaggggagggg
gaagaccggcatctctatcttgagtctctctggaaggctgagcagggggtggcggagggc
ataaagaggattgcttcaggcaagcttccctgggggaggattgatgttgatcgctctgtg
agggaggctgaagagcgatcacgccttgaactctccccctcacagcgcgaagcggtgcgc
cttgcgcttacaagtaagctgcttgtcattactggcggcccgggtgtgggtaaaaccacc
atcatccggacactgctctccattcctgaggtgttcgggctcagtgtgctgctctgcgct
cctacaggcagggcggccaaacggctcggtgaggctaccggacgggagggaagaaccatc
caccggatgcttgagttcgacccctatacctacgacttcaaacgctgttcctccaatcct
ctcaatgccgacatcatcattgttgatgaagcttccatgattgatgtggtgcttatgaac
cgcctgctctcggccatttccagtaaggctgcagtcgttcttgccggtgatgtcgaccag
cttccccctgtcgggcccggtgccgttctggcagatgtcatcagctccgaagctgttcct
gttgtccgcctgacagagattttccggcaggccgcacagtcgatgatcattcagaacgct
caccgcatcaaccgtggggagggacttcttcgccatgaggggcccgaactgacagacttt
tattttgtctctgcctccggcccggaagagatacgccgcaaactcctttctgttgtggcc
cagaggatccccgagcgattcggactcgacccgctggagggtatccaggtgctgactcca
atgaacaagggccctctgggttcgcagtcgctcaacacccttctgcaggagcgcctgaac
ggcgggggaggcaagcgggttgaacggttcgcagtcacctatggccgtggcgacaaggtg
attcagaccatcaacaactatgaaaaagaggtgttcaacggcgacatcgggataatctcc
tctatagatgatgacgaccgggagatgcaggtgctgtttgatggccgtgaggtgcgttac
cttttcagtgagcttgatgaaatggcgccggcatgggccattaccatccacaaaagccag
ggttcggaataccccgcagtggtcataccgctctccatgcttcactacccgatgctggag
cggaacctcatctatacggcggtaacaagggggagaaagctggtgatggttattggtgaa
gagcaagccttggcaacggccatcgccaggtgcacttctaagggtcgcctcaccggcctt
gctgccgcactccgccttccgataggctga

DBGET integrated database retrieval system