KEGG   Chlorobium phaeovibrioides: Cvib_1275Help
Entry
Cvib_1275         CDS       T00499                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_1275 (tpiA)
   01230 Biosynthesis of amino acids
    Cvib_1275 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1275 (tpiA)
   00051 Fructose and mannose metabolism
    Cvib_1275 (tpiA)
   00562 Inositol phosphate metabolism
    Cvib_1275 (tpiA)
Enzymes [BR:pvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cvib_1275 (tpiA)
Exosome [BR:pvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cvib_1275 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cvib_1275 (tpiA)
  Exosomal proteins of melanoma cells
   Cvib_1275 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1428484..1429236)
Genome map
AA seq 250 aa AA seqDB search
MRRKIVVGNWKMNKTVAESTELASAVVAALGSDCSACEAGIAPTYPALDSVGRTIKGSEV
LLVAQNCHYEDDGAFTGEVSTGMLNALGCSYVIIGHSERRQYFGETDATVNLRIKKVLAA
GMKAILCVGETLEERESGAFEAVVSTQVTGGLQGVVDISDIVIAYEPVWAIGTGRTASSE
QAQEVHKIIRNKVAELYGAPAADAVRIQYGGSVKPSNAAELFAMPDIDGGLIGGAALKAE
DFAAIVKAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaaattgttgtcggaaactggaaaatgaacaagacggtcgctgaatcgacc
gaacttgcctcggcagttgttgctgcgcttggaagcgactgttcagcatgcgaggccggt
attgcaccgacctatcctgcacttgactcagttggccgcaccataaagggaagtgaagtt
cttcttgtggcacagaactgccattatgaagatgacggggcatttaccggagaggtttca
accggcatgctcaacgctcttggatgctcttatgtcatcattggccattctgagcgccgt
cagtatttcggtgaaacagatgcaaccgtcaaccttcgcatcaaaaaagttcttgcagca
ggcatgaaagccattctctgtgtcggtgaaacccttgaagaacgggaatccggcgcgttt
gaggctgttgtttccacacaggtgaccggcggactgcagggcgttgttgacatcagcgac
attgtgattgcctatgagcctgtatgggccatcggtaccggcaggacagccagttcagag
caggctcaggaagtccataaaattattcgcaacaaggtcgcagaactctatggagcccct
gctgcagatgctgtgcgcattcagtatggcggaagcgtcaaaccttccaatgcggcagaa
ctctttgccatgcccgacattgacggcggcctcattggaggcgcagccctcaaggcagaa
gatttcgcggctatcgtcaaagctgcctgctga

DBGET integrated database retrieval system