KEGG   Chlorobium phaeovibrioides: Cvib_1293Help
Entry
Cvib_1293         CDS       T00499                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cvib_1293
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cvib_1293
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cvib_1293
Enzymes [BR:pvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cvib_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1447134..1448222
Genome map
AA seq 362 aa AA seqDB search
MKQAHPLYRKTVVKIGTNVITRKDGQLDFEVLASLTDQLAALRRQGVQVILVSSGAVGAG
RAIIKQPQNLSPVAVRQVLSSTGQIRLINTYNDLFARHGLVTAQILVTKSDFRDRLHYSN
MRTCFSALLQQGIIPVVNENDAVSVTELMFTDNDELSGLIASMMDAEGHIILSHVDGLFD
MSEGKETLITEIDPSAKHFHQYITPTKSEFGRGGMLTKCHIAQKLSKLGITVHIANGRTP
GILTRIFQGEAVGTRFLPEKAAHGPKKWIANSEGLEKGAVTVNQGAEAALLSTERANSLL
PVGIESITGSFHKGDIIKICSSDGHIIGYGMAQYSSEKTLPLIGLKDQKPLVHYDYLYIK
PV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcacatccgctctacagaaaaacggtcgtcaaaatcggcaccaatgtcatt
acccgaaaagatggccagcttgatttcgaggtacttgcaagcctcaccgatcagctcgca
gctctccgccgccaaggggtacaggtcatcctggtctcctcgggtgccgtcggcgcaggc
cgcgccatcatcaagcagccgcagaacctttcgcccgttgccgtccgtcaggtcctctct
tcaaccgggcagatacggctcatcaacacctacaacgatctgttcgcccggcacggccta
gttacggcacagattctggtaacaaaaagcgacttccgcgaccggctgcattacagcaac
atgcgcacctgtttctcagcactcctgcagcagggaatcatccccgtcgtcaacgaaaac
gatgcagtatcggtcactgaactcatgtttaccgacaacgacgaactctcggggctgata
gcctccatgatggatgccgaagggcacatcatcctctcccatgtagacggactgttcgac
atgtcagaaggcaaggaaaccctcatcacggaaattgatccttcagcaaaacattttcat
cagtacatcacccccaccaaatccgaattcggacggggaggaatgctgaccaaatgccat
attgcacaaaaactctccaaactcggcattacagtccacatcgccaacggacgcaccccc
ggcattctcacccggattttccagggcgaagcggtcggcaccagattcctgcccgaaaaa
gccgcacacgggccaaaaaagtggattgcaaacagtgaagggcttgaaaaaggagccgtc
acagtcaaccagggcgccgaagcagcactcctctccacagagcgtgccaacagcctcctg
cctgtgggcatagaatccattaccggctcctttcacaagggcgacatcatcaaaatctgc
tcctccgacggccacatcatcggctacggcatggcgcagtacagctcagaaaaaacccta
ccgctcatcggcctgaaagaccagaaacctctggttcattacgattacctttatataaaa
ccagtctga

DBGET integrated database retrieval system