KEGG   Chlorobium phaeovibrioides: Cvib_1390Help
Entry
Cvib_1390         CDS       T00499                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_1390
   01230 Biosynthesis of amino acids
    Cvib_1390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1390
   00030 Pentose phosphate pathway
    Cvib_1390
   00051 Fructose and mannose metabolism
    Cvib_1390
   00052 Galactose metabolism
    Cvib_1390
  Energy metabolism
   00680 Methane metabolism
    Cvib_1390
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cvib_1390
Enzymes [BR:pvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cvib_1390
Protein phosphatases and associated proteins [BR:pvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cvib_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1549576..1550781
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAQAKELELFIIPNGYAGLYNLIDQDHIVRLDQQR
LDRFDATFAGSEAGHSRVKVKAISNPEKYNRIKAGMKKFELDGLVISGGDDSGSVMVDLN
QNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAEFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPTDWDVVYDHLAERFTRRIRQNDVHSGTYTIVVAEGLKNAD
GSDIVDEGAGIDAFGHKKLAGAGKFTCQEIQKRMKADPAMPLFMKETGMFVEGIYEIPEV
REIHPGHLVRCGSSSAYDTNFGFEAGAAAVLLLLDGKTGVTVSKVKGRKVEYIASEKAIV
QRHVDLEQVSMYESLGICFGRKPVPYEPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcggcatcctcaccagcggtggcgactgcggcggtctcaatgcagtcctc
aaaggcgccgcgctcatggcgcaggcaaaagaacttgagctcttcatcatacccaacggc
tacgcaggactctacaacctcatcgaccaggaccacattgttcgtctcgaccagcagagg
ctcgaccggtttgacgcaacattcgccggctcggaagcaggccactcccgcgtaaaagtc
aaagccatcagcaacccggaaaaatacaaccgtatcaaagcggggatgaaaaagtttgag
cttgacggccttgtcatcagcggcggcgacgactcaggcagcgtcatggttgacctcaac
cagaatggaatccagtgcatccacgcaccaaaaacaatggacctcgacctgcagacctac
tcggtcgggggcgactcgacaatcaaccgcatcgcagaattcgtccacgacctgaaaaca
accggcaaaacccacaaccgggttcttgtcacagaagtcttcggccgttatgccggccat
acagccttccgcagcggcgttgccgccgaggcggactgcattctcattcctgaaatcccg
actgattgggatgtggtatacgatcaccttgcagaacgcttcacacgccgaatccgccag
aacgatgtccacagcgggacctacaccatcgttgtagccgaagggctcaaaaatgccgat
ggaagcgacattgtagatgaaggcgccggcattgacgcattcggacacaagaaacttgcg
ggtgcaggaaaattcacctgccaggaaatccagaagaggatgaaggccgaccctgccatg
ccgctcttcatgaaagagaccggaatgtttgttgaagggatctatgaaatcccggaggtt
cgtgaaatccatcccggccaccttgtgcgctgcggcagttcatcggcctacgacaccaac
ttcggctttgaggccggtgcggcagccgtcctgcttctccttgatgggaaaacaggtgtt
actgtatcgaaagtcaaagggcgcaaggttgaatacattgcatcggaaaaagccattgtg
cagcgacatgttgatcttgaacaggtctccatgtacgaatcgctcggcatctgctttggc
cgcaaaccggttccctacgagccgattcttcgtgaagtcgacggcgtctacgaaaggatc
tactga

DBGET integrated database retrieval system