KEGG   Chlorobium phaeovibrioides: Cvib_1426Help
Entry
Cvib_1426         CDS       T00499                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pvi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pvi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pvi00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pvi00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pvi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1591737..1593770
Genome map
AA seq 677 aa AA seqDB search
MPPKKRNPVIFSTHKSWRSMATDDNKKGTDSISSVMSEKRKFPPPAAFSEKARIGSMEEY
ETLYKAAAEDPDSYWGGLAEEFHWFKKWDSVLEWDTPYAKWFNGGTTNICYNAVDVHANS
WRKNKAAIIWEGEEGEQRVLTYGELHRQVSKFANVLRIAGIKPGDRVAIYMGMVPELVIA
VLACARVGAVHNVIFAGFSAHAITERVNDSRAKLIICCDGTRRRGGSINLKNIVDEAIVN
TPSVRSVIVLKVTGEEISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGK
PKGILHTTAGYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMY
EGAPNYPQWDRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPI
NPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQ
KDGTPCGPNEGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYI
WIMGRVDDVVNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYE
GDMKLREALRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTT
LEDFGVLETLREKEDES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaagaggaatcccgtgattttttcaacacataaatcctggcgatcaatg
gctacagacgacaacaagaaagggacagactcgataagctctgtcatgtctgaaaagcga
aaatttcctcctccggcagcattttcggaaaaagcccgaatcggaagcatggaagagtac
gaaacactgtacaaggcagccgcagaggaccccgacagctactggggaggccttgccgaa
gagtttcactggttcaaaaagtgggacagcgtgctcgaatgggataccccctatgcaaaa
tggttcaacggcggcaccacaaacatctgctacaatgccgttgatgttcacgccaacagc
tggagaaaaaacaaagccgccatcatatgggaaggcgaagagggtgagcagcgggtactc
acctacggggaactccaccgccaggtctcaaagttcgccaatgtactgagaattgcagga
atcaagcccggtgaccgcgtagcaatctacatgggcatggtgcctgaactggtcatagct
gttctggcatgtgcgcgagtaggcgctgtccacaatgtcatcttcgcaggtttttcagcc
cacgccattaccgaacgggtcaacgactcccgcgcaaaactcatcatctgctgtgacggc
acccgtcgccgcggtggctcaatcaacctcaagaatattgtcgacgaggcaatcgtcaac
accccttccgtccgcagcgtcatcgtcctgaaggtgaccggagaggaaatcagcatgcac
gacggcatggatcactggtggcacgacctcatggggctggcatccgacgaatctgaaccc
gtggaggttgaatccgaacatccgctcttcgtcctctacaccagtggctcaacaggaaaa
cccaaaggcattctgcataccaccgccggctacatggtccacgcagcaagttcgttccgc
tatgtcttcgacatccgcgacgatgacatctactggtgtactgctgatgtcggctggatc
accggccacagctacatggtctacggcccgcttctcaacggcgcaaccctgctcatgtat
gaaggggccccgaactacccccagtgggaccgcttctgggacatcatcaaccgccacaaa
gtcaccattctctacacggcccctaccgccatacgcgccttcatccgtgccggcgatgaa
tgggtcaccaagcacaacctcagttcgctgcgccttctgggtacagtcggcgaaccgatc
aaccccgaagcctggatgtggtatcacagggtggtagggcaggagaaatgcccgattgtc
gacacctggtggcagactgaaaccggcggcatcatggtctctccccttcccggagcaacc
ccgaccaaacccggcaccgcaacccgtccccttcccggcatcatggcagatgttgtccag
aaagacggcaccccatgcggcccgaatgaaggcggctacctggtcatcaaaaagccatgg
ccatcaatgctccgtaccatctacggcgacaacaaacggtatgaagaaacctactggtcg
gaattccacgacatgtacttcacaggtgacggtgcacgaaaggatgaggacggttacatc
tggatcatgggccgtgttgatgatgtggtcaatgtatcaggtcacaggctcggcaccagc
gaagttgaaagcgccctcgtctcatacgaggccgttgcagaagctgcagtagtcagccgt
cccgacgacatcaagggcaacgctcttgttgccttcgtcaccctcaaggacgaatacgaa
ggcgacatgaagttgcgtgaggcactgcgcaaccatgtagcaaaggagatcggccccata
gccaaacccgacgaaatcaggtgggcgaaaggactcccgaaaacccgaagcggcaaaatc
atgcgtcgcctcctccgcgagctggcaaccagcaacgaaatcaagggagatgtcaccacc
cttgaagacttcggcgttcttgaaaccctccgcgagaaggaagatgaaagctga

DBGET integrated database retrieval system