KEGG   Chlorobium phaeovibrioides: Cvib_1426Help
Entry
Cvib_1426         CDS       T00499                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_1426
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1426
   00620 Pyruvate metabolism
    Cvib_1426
   00640 Propanoate metabolism
    Cvib_1426
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cvib_1426
   00680 Methane metabolism
    Cvib_1426
Enzymes [BR:pvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cvib_1426
Lipid biosynthesis proteins [BR:pvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cvib_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1591737..1593770
Genome map
AA seq 677 aa AA seqDB search
MPPKKRNPVIFSTHKSWRSMATDDNKKGTDSISSVMSEKRKFPPPAAFSEKARIGSMEEY
ETLYKAAAEDPDSYWGGLAEEFHWFKKWDSVLEWDTPYAKWFNGGTTNICYNAVDVHANS
WRKNKAAIIWEGEEGEQRVLTYGELHRQVSKFANVLRIAGIKPGDRVAIYMGMVPELVIA
VLACARVGAVHNVIFAGFSAHAITERVNDSRAKLIICCDGTRRRGGSINLKNIVDEAIVN
TPSVRSVIVLKVTGEEISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGK
PKGILHTTAGYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMY
EGAPNYPQWDRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPI
NPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQ
KDGTPCGPNEGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYI
WIMGRVDDVVNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYE
GDMKLREALRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTT
LEDFGVLETLREKEDES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaagaggaatcccgtgattttttcaacacataaatcctggcgatcaatg
gctacagacgacaacaagaaagggacagactcgataagctctgtcatgtctgaaaagcga
aaatttcctcctccggcagcattttcggaaaaagcccgaatcggaagcatggaagagtac
gaaacactgtacaaggcagccgcagaggaccccgacagctactggggaggccttgccgaa
gagtttcactggttcaaaaagtgggacagcgtgctcgaatgggataccccctatgcaaaa
tggttcaacggcggcaccacaaacatctgctacaatgccgttgatgttcacgccaacagc
tggagaaaaaacaaagccgccatcatatgggaaggcgaagagggtgagcagcgggtactc
acctacggggaactccaccgccaggtctcaaagttcgccaatgtactgagaattgcagga
atcaagcccggtgaccgcgtagcaatctacatgggcatggtgcctgaactggtcatagct
gttctggcatgtgcgcgagtaggcgctgtccacaatgtcatcttcgcaggtttttcagcc
cacgccattaccgaacgggtcaacgactcccgcgcaaaactcatcatctgctgtgacggc
acccgtcgccgcggtggctcaatcaacctcaagaatattgtcgacgaggcaatcgtcaac
accccttccgtccgcagcgtcatcgtcctgaaggtgaccggagaggaaatcagcatgcac
gacggcatggatcactggtggcacgacctcatggggctggcatccgacgaatctgaaccc
gtggaggttgaatccgaacatccgctcttcgtcctctacaccagtggctcaacaggaaaa
cccaaaggcattctgcataccaccgccggctacatggtccacgcagcaagttcgttccgc
tatgtcttcgacatccgcgacgatgacatctactggtgtactgctgatgtcggctggatc
accggccacagctacatggtctacggcccgcttctcaacggcgcaaccctgctcatgtat
gaaggggccccgaactacccccagtgggaccgcttctgggacatcatcaaccgccacaaa
gtcaccattctctacacggcccctaccgccatacgcgccttcatccgtgccggcgatgaa
tgggtcaccaagcacaacctcagttcgctgcgccttctgggtacagtcggcgaaccgatc
aaccccgaagcctggatgtggtatcacagggtggtagggcaggagaaatgcccgattgtc
gacacctggtggcagactgaaaccggcggcatcatggtctctccccttcccggagcaacc
ccgaccaaacccggcaccgcaacccgtccccttcccggcatcatggcagatgttgtccag
aaagacggcaccccatgcggcccgaatgaaggcggctacctggtcatcaaaaagccatgg
ccatcaatgctccgtaccatctacggcgacaacaaacggtatgaagaaacctactggtcg
gaattccacgacatgtacttcacaggtgacggtgcacgaaaggatgaggacggttacatc
tggatcatgggccgtgttgatgatgtggtcaatgtatcaggtcacaggctcggcaccagc
gaagttgaaagcgccctcgtctcatacgaggccgttgcagaagctgcagtagtcagccgt
cccgacgacatcaagggcaacgctcttgttgccttcgtcaccctcaaggacgaatacgaa
ggcgacatgaagttgcgtgaggcactgcgcaaccatgtagcaaaggagatcggccccata
gccaaacccgacgaaatcaggtgggcgaaaggactcccgaaaacccgaagcggcaaaatc
atgcgtcgcctcctccgcgagctggcaaccagcaacgaaatcaagggagatgtcaccacc
cttgaagacttcggcgttcttgaaaccctccgcgagaaggaagatgaaagctga

DBGET integrated database retrieval system