KEGG   Chlorobium phaeovibrioides: Cvib_1426Help
Entry
Cvib_1426         CDS       T00499                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00010  Glycolysis / Gluconeogenesis
pvi00620  Pyruvate metabolism
pvi00640  Propanoate metabolism
pvi00680  Methane metabolism
pvi00720  Carbon fixation pathways in prokaryotes
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01120  Microbial metabolism in diverse environments
pvi01130  Biosynthesis of antibiotics
pvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1426
   00620 Pyruvate metabolism
    Cvib_1426
   00640 Propanoate metabolism
    Cvib_1426
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cvib_1426
   00680 Methane metabolism
    Cvib_1426
Enzymes [BR:pvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cvib_1426
Lipid biosynthesis proteins [BR:pvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cvib_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP37437
UniProt: A4SG28
Position
1591737..1593770
Genome map
AA seq 677 aa AA seqDB search
MPPKKRNPVIFSTHKSWRSMATDDNKKGTDSISSVMSEKRKFPPPAAFSEKARIGSMEEY
ETLYKAAAEDPDSYWGGLAEEFHWFKKWDSVLEWDTPYAKWFNGGTTNICYNAVDVHANS
WRKNKAAIIWEGEEGEQRVLTYGELHRQVSKFANVLRIAGIKPGDRVAIYMGMVPELVIA
VLACARVGAVHNVIFAGFSAHAITERVNDSRAKLIICCDGTRRRGGSINLKNIVDEAIVN
TPSVRSVIVLKVTGEEISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGK
PKGILHTTAGYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMY
EGAPNYPQWDRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPI
NPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQ
KDGTPCGPNEGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYI
WIMGRVDDVVNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYE
GDMKLREALRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTT
LEDFGVLETLREKEDES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaagaggaatcccgtgattttttcaacacataaatcctggcgatcaatg
gctacagacgacaacaagaaagggacagactcgataagctctgtcatgtctgaaaagcga
aaatttcctcctccggcagcattttcggaaaaagcccgaatcggaagcatggaagagtac
gaaacactgtacaaggcagccgcagaggaccccgacagctactggggaggccttgccgaa
gagtttcactggttcaaaaagtgggacagcgtgctcgaatgggataccccctatgcaaaa
tggttcaacggcggcaccacaaacatctgctacaatgccgttgatgttcacgccaacagc
tggagaaaaaacaaagccgccatcatatgggaaggcgaagagggtgagcagcgggtactc
acctacggggaactccaccgccaggtctcaaagttcgccaatgtactgagaattgcagga
atcaagcccggtgaccgcgtagcaatctacatgggcatggtgcctgaactggtcatagct
gttctggcatgtgcgcgagtaggcgctgtccacaatgtcatcttcgcaggtttttcagcc
cacgccattaccgaacgggtcaacgactcccgcgcaaaactcatcatctgctgtgacggc
acccgtcgccgcggtggctcaatcaacctcaagaatattgtcgacgaggcaatcgtcaac
accccttccgtccgcagcgtcatcgtcctgaaggtgaccggagaggaaatcagcatgcac
gacggcatggatcactggtggcacgacctcatggggctggcatccgacgaatctgaaccc
gtggaggttgaatccgaacatccgctcttcgtcctctacaccagtggctcaacaggaaaa
cccaaaggcattctgcataccaccgccggctacatggtccacgcagcaagttcgttccgc
tatgtcttcgacatccgcgacgatgacatctactggtgtactgctgatgtcggctggatc
accggccacagctacatggtctacggcccgcttctcaacggcgcaaccctgctcatgtat
gaaggggccccgaactacccccagtgggaccgcttctgggacatcatcaaccgccacaaa
gtcaccattctctacacggcccctaccgccatacgcgccttcatccgtgccggcgatgaa
tgggtcaccaagcacaacctcagttcgctgcgccttctgggtacagtcggcgaaccgatc
aaccccgaagcctggatgtggtatcacagggtggtagggcaggagaaatgcccgattgtc
gacacctggtggcagactgaaaccggcggcatcatggtctctccccttcccggagcaacc
ccgaccaaacccggcaccgcaacccgtccccttcccggcatcatggcagatgttgtccag
aaagacggcaccccatgcggcccgaatgaaggcggctacctggtcatcaaaaagccatgg
ccatcaatgctccgtaccatctacggcgacaacaaacggtatgaagaaacctactggtcg
gaattccacgacatgtacttcacaggtgacggtgcacgaaaggatgaggacggttacatc
tggatcatgggccgtgttgatgatgtggtcaatgtatcaggtcacaggctcggcaccagc
gaagttgaaagcgccctcgtctcatacgaggccgttgcagaagctgcagtagtcagccgt
cccgacgacatcaagggcaacgctcttgttgccttcgtcaccctcaaggacgaatacgaa
ggcgacatgaagttgcgtgaggcactgcgcaaccatgtagcaaaggagatcggccccata
gccaaacccgacgaaatcaggtgggcgaaaggactcccgaaaacccgaagcggcaaaatc
atgcgtcgcctcctccgcgagctggcaaccagcaacgaaatcaagggagatgtcaccacc
cttgaagacttcggcgttcttgaaaccctccgcgagaaggaagatgaaagctga

DBGET integrated database retrieval system