KEGG   Chlorobium phaeovibrioides: Cvib_1426Help
Entry
Cvib_1426         CDS       T00499                                 

Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cvib_1426
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1426
   00620 Pyruvate metabolism
    Cvib_1426
   00640 Propanoate metabolism
    Cvib_1426
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cvib_1426
   00680 Methane metabolism
    Cvib_1426
Enzymes [BR:pvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cvib_1426
Lipid biosynthesis proteins [BR:pvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cvib_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1591737..1593770
Genome map
AA seq 677 aa AA seqDB search
MPPKKRNPVIFSTHKSWRSMATDDNKKGTDSISSVMSEKRKFPPPAAFSEKARIGSMEEY
ETLYKAAAEDPDSYWGGLAEEFHWFKKWDSVLEWDTPYAKWFNGGTTNICYNAVDVHANS
WRKNKAAIIWEGEEGEQRVLTYGELHRQVSKFANVLRIAGIKPGDRVAIYMGMVPELVIA
VLACARVGAVHNVIFAGFSAHAITERVNDSRAKLIICCDGTRRRGGSINLKNIVDEAIVN
TPSVRSVIVLKVTGEEISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGK
PKGILHTTAGYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMY
EGAPNYPQWDRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPI
NPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQ
KDGTPCGPNEGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYI
WIMGRVDDVVNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYE
GDMKLREALRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTT
LEDFGVLETLREKEDES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaagaggaatcccgtgattttttcaacacataaatcctggcgatcaatg
gctacagacgacaacaagaaagggacagactcgataagctctgtcatgtctgaaaagcga
aaatttcctcctccggcagcattttcggaaaaagcccgaatcggaagcatggaagagtac
gaaacactgtacaaggcagccgcagaggaccccgacagctactggggaggccttgccgaa
gagtttcactggttcaaaaagtgggacagcgtgctcgaatgggataccccctatgcaaaa
tggttcaacggcggcaccacaaacatctgctacaatgccgttgatgttcacgccaacagc
tggagaaaaaacaaagccgccatcatatgggaaggcgaagagggtgagcagcgggtactc
acctacggggaactccaccgccaggtctcaaagttcgccaatgtactgagaattgcagga
atcaagcccggtgaccgcgtagcaatctacatgggcatggtgcctgaactggtcatagct
gttctggcatgtgcgcgagtaggcgctgtccacaatgtcatcttcgcaggtttttcagcc
cacgccattaccgaacgggtcaacgactcccgcgcaaaactcatcatctgctgtgacggc
acccgtcgccgcggtggctcaatcaacctcaagaatattgtcgacgaggcaatcgtcaac
accccttccgtccgcagcgtcatcgtcctgaaggtgaccggagaggaaatcagcatgcac
gacggcatggatcactggtggcacgacctcatggggctggcatccgacgaatctgaaccc
gtggaggttgaatccgaacatccgctcttcgtcctctacaccagtggctcaacaggaaaa
cccaaaggcattctgcataccaccgccggctacatggtccacgcagcaagttcgttccgc
tatgtcttcgacatccgcgacgatgacatctactggtgtactgctgatgtcggctggatc
accggccacagctacatggtctacggcccgcttctcaacggcgcaaccctgctcatgtat
gaaggggccccgaactacccccagtgggaccgcttctgggacatcatcaaccgccacaaa
gtcaccattctctacacggcccctaccgccatacgcgccttcatccgtgccggcgatgaa
tgggtcaccaagcacaacctcagttcgctgcgccttctgggtacagtcggcgaaccgatc
aaccccgaagcctggatgtggtatcacagggtggtagggcaggagaaatgcccgattgtc
gacacctggtggcagactgaaaccggcggcatcatggtctctccccttcccggagcaacc
ccgaccaaacccggcaccgcaacccgtccccttcccggcatcatggcagatgttgtccag
aaagacggcaccccatgcggcccgaatgaaggcggctacctggtcatcaaaaagccatgg
ccatcaatgctccgtaccatctacggcgacaacaaacggtatgaagaaacctactggtcg
gaattccacgacatgtacttcacaggtgacggtgcacgaaaggatgaggacggttacatc
tggatcatgggccgtgttgatgatgtggtcaatgtatcaggtcacaggctcggcaccagc
gaagttgaaagcgccctcgtctcatacgaggccgttgcagaagctgcagtagtcagccgt
cccgacgacatcaagggcaacgctcttgttgccttcgtcaccctcaaggacgaatacgaa
ggcgacatgaagttgcgtgaggcactgcgcaaccatgtagcaaaggagatcggccccata
gccaaacccgacgaaatcaggtgggcgaaaggactcccgaaaacccgaagcggcaaaatc
atgcgtcgcctcctccgcgagctggcaaccagcaacgaaatcaagggagatgtcaccacc
cttgaagacttcggcgttcttgaaaccctccgcgagaaggaagatgaaagctga

DBGET integrated database retrieval system