KEGG   Chlorobium phaeovibrioides: Cvib_1461Help
Entry
Cvib_1461         CDS       T00499                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00790  Folate biosynthesis
pvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cvib_1461
Enzymes [BR:pvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cvib_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABP37472
UniProt: A4SG63
Position
1629794..1630744
Genome map
AA seq 316 aa AA seqDB search
MAPIRPETLTITCRNRLLDFQQGPKIMGILNTTPDSFHDGGAFEPHPDHPNQTPGSINLN
AALDKALTMLREGADIIDIGGESTRPGALPVTAEEETRRTAPLIAMLRRHTDALISIDTS
KAEVAEAALLAGADIVNDISGFTFDSEMAGICARHKAPAILMHAPLKPEAMQWSTDTLQG
NGDIVETVITFLKQAIKRAEAAGVRGIIIDPGFGFGKSVQENFTLLGRLKEFRQTGRPIL
AGVSRKSFLAHAIKSEGESSPPTADRLNATITAETIAILNGADIIRTHAVKAAAECCRVI
QAMRKTEPSEKPHQAE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccccaatcagacccgaaacccttaccattacctgccgaaaccgtctgcttgatttt
cagcagggccccaaaatcatgggcattctgaacaccacccccgactcattccacgacgga
ggggcgtttgaaccccacccggaccaccccaaccagacgcccggcagcataaacctgaat
gccgcactggacaaggctctcaccatgctccgcgaaggggccgacatcatcgacatcggc
ggagaatcaacacggcccggagcattgcccgtcaccgccgaagaggaaacccggcgaacc
gccccgctcatagccatgctccgccgacatacagacgcactcatctccatagacacaagc
aaggctgaagttgccgaagccgcactgctcgcaggagccgacattgtcaatgacatctcc
ggctttaccttcgactccgaaatggcaggaatatgcgcccggcacaaagcgccagcaatc
ctgatgcacgccccattaaaacctgaagccatgcagtggagcaccgacacactgcagggg
aatggtgatattgtcgaaaccgtcatcacatttctgaaacaagccatcaaacgggccgaa
gcagccggagtaaggggcatcatcatcgaccccggattcggattcggcaaaagcgttcaa
gaaaacttcacgcttctggggcgcctcaaggagtttcgccagacagggcggccaatccta
gccggagtgtcaagaaaatcttttttggctcatgcaatcaaaagtgagggggaaagctcc
ccgccaactgccgacaggctgaatgccacaataacagctgaaaccatagccatcctgaac
ggtgcagatatcatccggacacacgcagtcaaagccgctgccgaatgctgcagggtcata
caggcgatgcggaaaactgaaccctcagaaaaaccgcatcaggccgaataa

DBGET integrated database retrieval system