KEGG   Chlorobium phaeovibrioides: Cvib_1555Help
Entry
Cvib_1555         CDS       T00499                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00230  Purine metabolism
pvi01100  Metabolic pathways
Module
pvi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cvib_1555
Enzymes [BR:pvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cvib_1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 AAA Mg_chelatase APS_kinase RsgA_GTPase Thymidylate_kin NTPase_1 AAA_25 Cytidylate_kin AAA_30
Motif
Other DBs
NCBI-ProteinID: ABP37565
UniProt: A4SGF6
Position
complement(1726536..1727120)
Genome map
AA seq 194 aa AA seqDB search
MTEEQKQQGKLVVFSAPSGTGKSTIARRVMRKLPELQFSVSATTRSMRPGEVDGVNYHFL
SAEAFDGLVRSGGFIEHEFFFGNHYGTLLEKTSEAVRDGRHLLLDLDVKGALNLKKLFPA
NSLLVFIRPPSMEVLKERLQGRGSEDEAGLKLRLERASLELEYADRFDVVFVNDLLDETV
DAVTDSIRSFLSNK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagagcagaaacagcagggaaagctggtggttttttcagctccttcaggaaca
gggaagtccaccatagcccggcgtgttatgcgaaagctgcctgagctgcagttttccgtt
tcagccacaacccgcagtatgcggcccggagaggtggatggggtgaattaccattttctt
tccgccgaggcttttgacgggctggtgcgtagtggtggttttattgaacacgagttcttt
ttcggcaaccattacggaactcttctggagaaaaccagtgaggctgtaagagatggacgc
caccttctgcttgatctggatgtgaagggggcgttgaacctgaaaaagcttttccctgcg
aactcgctgcttgtatttattcgtcctccgagcatggaggttctcaaagagcgcttacag
ggaagggggagcgaagacgaggcaggcctgaagctgcgcctggagcgtgcgtccctggag
cttgaatatgctgaccggttcgatgttgtttttgtcaatgacttacttgatgagacggtt
gatgccgtcactgactccatcagaagttttctttcaaacaagtaa

DBGET integrated database retrieval system