KEGG   Chlorobium phaeovibrioides: Cvib_1577Help
Entry
Cvib_1577         CDS       T00499                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00260  Glycine, serine and threonine metabolism
pvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01130  Biosynthesis of antibiotics
pvi01230  Biosynthesis of amino acids
Module
pvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_1577
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cvib_1577
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cvib_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABP37587
UniProt: A4SGH8
Position
1754090..1755526
Genome map
AA seq 478 aa AA seqDB search
MSPLLRGLQHPLPVLPATLIFTTMSTEPTKILLTEDEMPRQWYNIQADLPVPLPPPVGMN
GVPIGPDDLARVFPMNLIEQEMSTERWIDIPDEIQGILKLWRPSPLYRARRLEAALGTPA
KIYYKNEGVSPAGSHKPNTAVAQAWYNKQFGIKYLTTETGAGQWGSALAMSCKLVGIECK
VFMVRISFDQKPFRKIMMKTWGADCIPSPSMETAVGRKILSEMPDTPGSLAIAISEAIEQ
AVEREDTRYALGSVLNHVMMHQTIIGLEAKKQLEKVGRYPDVVIGCAGGGSNFAGISFPF
ICDKIHGKEVRIIATEPEACPTLTRGPYVYDAGDVAKMTPLLPMHSLGHGFIPPAIHAGG
LRYHGMAPLVSHVRQLGLIEANSLPQTECYEAALLFAHTEGFIPAPETSHAIAETIREAK
KAKEEGKEKVILMNWSGHGLMDLQGYDAFMSGKISDYPLPEEMLQRSLDALKDHPPVA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcttttgcggggtctacaacatcccttgcccgttctgcccgcaacattaata
tttaccaccatgagcactgaaccgacgaagattctccttactgaagatgaaatgccgcgt
cagtggtataacattcaggctgatcttccggttccgcttcctcctcctgtggggatgaat
ggcgttccgatagggccggacgatctggcccgggtgtttccgatgaacctgattgaacag
gagatgagtacggagcggtggattgatattcctgatgaaatccaggggattttaaagctg
tggcgcccttctcctttgtacagggcacggcgccttgaggcggctttggggactcctgca
aagatttattacaagaacgagggggtatcgcccgcgggaagccataaaccgaacactgct
gtggcgcaggcctggtacaacaaacagttcggcatcaagtacctgaccacggaaacgggg
gccggccaatggggcagcgctctggcgatgagctgtaagcttgtggggattgagtgcaag
gtgtttatggtgcgaatcagttttgatcagaaacccttccgcaaaatcatgatgaaaacc
tggggggcggattgcattccgagcccgagcatggagacggctgtcggaagaaagattctc
agtgagatgcccgacacgccgggcagccttgctatcgccatcagcgaggcaattgagcag
gcggtggagcgcgaggatacccgctatgcgcttggcagtgtgctgaaccatgtcatgatg
catcagaccatcattgggcttgaggcgaagaagcagctggaaaaggttgggagatatccg
gatgtggtaattggctgcgcagggggtggatcaaactttgccggcatcagcttccccttc
atctgcgacaaaattcacgggaaagaggtgcgcatcattgccacagagcctgaagcatgc
cctacactgacgaggggtccgtatgtgtatgacgcgggtgatgttgcaaagatgacacca
ctcctgccaatgcacagcctcggccacgggttcattcctccggccattcacgcaggtggg
ctgcggtaccacggcatggcgcctcttgtcagccatgtgcgccagcttgggctgattgaa
gcgaactcgctgccgcagaccgagtgctacgaggcagcactgctgttcgctcatacggaa
ggattcattcctgcgcctgaaacatcccatgccattgccgaaaccatccgcgaggccaaa
aaagcgaaggaggaagggaaggagaaggtgattctgatgaactggtcagggcatggactg
atggatctacaggggtacgacgcgttcatgtcagggaaaatcagcgactatccgctgccc
gaggagatgctccagcgatcgctcgatgcgctgaaagaccatcctcctgtagcctga

DBGET integrated database retrieval system