KEGG   Chlorobium phaeovibrioides: Cvib_1577Help
Entry
Cvib_1577         CDS       T00499                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cvib_1577
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_1577
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cvib_1577
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cvib_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754090..1755526
Genome map
AA seq 478 aa AA seqDB search
MSPLLRGLQHPLPVLPATLIFTTMSTEPTKILLTEDEMPRQWYNIQADLPVPLPPPVGMN
GVPIGPDDLARVFPMNLIEQEMSTERWIDIPDEIQGILKLWRPSPLYRARRLEAALGTPA
KIYYKNEGVSPAGSHKPNTAVAQAWYNKQFGIKYLTTETGAGQWGSALAMSCKLVGIECK
VFMVRISFDQKPFRKIMMKTWGADCIPSPSMETAVGRKILSEMPDTPGSLAIAISEAIEQ
AVEREDTRYALGSVLNHVMMHQTIIGLEAKKQLEKVGRYPDVVIGCAGGGSNFAGISFPF
ICDKIHGKEVRIIATEPEACPTLTRGPYVYDAGDVAKMTPLLPMHSLGHGFIPPAIHAGG
LRYHGMAPLVSHVRQLGLIEANSLPQTECYEAALLFAHTEGFIPAPETSHAIAETIREAK
KAKEEGKEKVILMNWSGHGLMDLQGYDAFMSGKISDYPLPEEMLQRSLDALKDHPPVA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcttttgcggggtctacaacatcccttgcccgttctgcccgcaacattaata
tttaccaccatgagcactgaaccgacgaagattctccttactgaagatgaaatgccgcgt
cagtggtataacattcaggctgatcttccggttccgcttcctcctcctgtggggatgaat
ggcgttccgatagggccggacgatctggcccgggtgtttccgatgaacctgattgaacag
gagatgagtacggagcggtggattgatattcctgatgaaatccaggggattttaaagctg
tggcgcccttctcctttgtacagggcacggcgccttgaggcggctttggggactcctgca
aagatttattacaagaacgagggggtatcgcccgcgggaagccataaaccgaacactgct
gtggcgcaggcctggtacaacaaacagttcggcatcaagtacctgaccacggaaacgggg
gccggccaatggggcagcgctctggcgatgagctgtaagcttgtggggattgagtgcaag
gtgtttatggtgcgaatcagttttgatcagaaacccttccgcaaaatcatgatgaaaacc
tggggggcggattgcattccgagcccgagcatggagacggctgtcggaagaaagattctc
agtgagatgcccgacacgccgggcagccttgctatcgccatcagcgaggcaattgagcag
gcggtggagcgcgaggatacccgctatgcgcttggcagtgtgctgaaccatgtcatgatg
catcagaccatcattgggcttgaggcgaagaagcagctggaaaaggttgggagatatccg
gatgtggtaattggctgcgcagggggtggatcaaactttgccggcatcagcttccccttc
atctgcgacaaaattcacgggaaagaggtgcgcatcattgccacagagcctgaagcatgc
cctacactgacgaggggtccgtatgtgtatgacgcgggtgatgttgcaaagatgacacca
ctcctgccaatgcacagcctcggccacgggttcattcctccggccattcacgcaggtggg
ctgcggtaccacggcatggcgcctcttgtcagccatgtgcgccagcttgggctgattgaa
gcgaactcgctgccgcagaccgagtgctacgaggcagcactgctgttcgctcatacggaa
ggattcattcctgcgcctgaaacatcccatgccattgccgaaaccatccgcgaggccaaa
aaagcgaaggaggaagggaaggagaaggtgattctgatgaactggtcagggcatggactg
atggatctacaggggtacgacgcgttcatgtcagggaaaatcagcgactatccgctgccc
gaggagatgctccagcgatcgctcgatgcgctgaaagaccatcctcctgtagcctga

DBGET integrated database retrieval system