KEGG   Chlorobium phaeovibrioides: Cvib_1630Help
Entry
Cvib_1630         CDS       T00499                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00260  Glycine, serine and threonine metabolism
pvi00750  Vitamin B6 metabolism
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01120  Microbial metabolism in diverse environments
pvi01230  Biosynthesis of amino acids
Module
pvi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_1630
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cvib_1630
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cvib_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABP37640
UniProt: A4SGN1
Position
1819142..1820455
Genome map
AA seq 437 aa AA seqDB search
MIYFSTSKASTPVSIKRATLEGLAPDGGLYVPSEIPTFSSGELSLLESAGFSDIALAIAK
KFIEGEIPPDILQDLVASCYDFPTPIISLDGSTFVEELFHGPTLAFKDYGARFLGRLTGR
FAAEDHRLITVLVATSGDTGSAVASGFHGIANTRVVILYPSGKVSRLQEQQLTTAGGNVH
ALEVRGDFDDCQRLVKEAFVDPELRMRHTLTSANSINIARLIPQSFYYAWATLELKRQYG
LDKPLFSVPSGNYGNLTAGVLAKRMGFPIGHFIAASNTNDSVTRYLEEGRYEPRPTRRTL
STAMDVGNPSNFARLRHFYGDSREAMAADITGISITDKETMETIRNSRERFDYLMDPHTA
VGFAALEKYRMKSGSSCPGVVLSTAHPAKFREAMQDTLQEEVDVPERLASCLNLKKESTL
INPDFRDLSSFLNGLDT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatctacttcagcacaagcaaagcctcgacaccggtctctataaaacgggcaaccctt
gaggggctggcccccgacggcgggctctatgtcccctctgaaatcccgacattttcatcg
ggggagctttcgctgcttgaaagcgccggcttcagcgacattgcgctggccatagctaaa
aaattcatcgaaggggagattccccccgacatcctgcaggatctcgttgcttcatgctac
gatttccccacccccatcatctctcttgacgggtccacctttgttgaggaactgttccat
ggaccgaccctcgccttcaaggattacggagcccgatttctcggccgcctgaccggcaga
ttcgccgccgaggaccaccgcctgattaccgtgcttgtggcaacctccggtgacaccggc
agcgcagtggcatcgggttttcatggtatcgccaacacccgcgtcgtcattctctaccct
tcaggcaaggtaagccgtcttcaggaacagcagctcacaaccgctggcggcaatgttcat
gcgcttgaggttcggggcgactttgacgactgccagaggcttgtcaaagaggcttttgtc
gaccctgaactcaggatgcgccacacactgacctcagccaactccatcaacattgcacga
ctgattccacagtcattttactacgcatgggcaacactggagctgaagcggcagtacggc
ctcgataaacctctcttctccgtaccaagcggaaactatggcaacctcacggcaggcgtc
ctggcaaagaggatgggattccccattggccacttcatagccgcctccaatactaacgac
agcgtgacacgctatcttgaagagggccggtacgagccgcgcccaaccagaaggaccctg
tcaacggccatggatgttggcaacccgagcaatttcgcacgactccgccatttctacggc
gacagccgtgaagcaatggccgctgacattacaggcatcagcatcaccgacaaggagacc
atggaaacaatccgaaactcaagagaacggttcgattatctcatggaccctcataccgca
gtcggctttgcagcccttgaaaagtaccggatgaagagcggaagcagctgccccggagtt
gtcctctccactgcgcacccggcaaaatttcgtgaggcgatgcaggacacccttcaagaa
gaagtggatgttcccgagaggcttgcatcctgtctcaacctcaaaaaagagtcaaccctc
atcaatcccgattttcgcgatctgtcgtccttcctcaacgggcttgacacataa

DBGET integrated database retrieval system