KEGG   Chlorobium phaeovibrioides: Cvib_1630Help
Entry
Cvib_1630         CDS       T00499                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cvib_1630
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cvib_1630
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cvib_1630
Enzymes [BR:pvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cvib_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1819142..1820455
Genome map
AA seq 437 aa AA seqDB search
MIYFSTSKASTPVSIKRATLEGLAPDGGLYVPSEIPTFSSGELSLLESAGFSDIALAIAK
KFIEGEIPPDILQDLVASCYDFPTPIISLDGSTFVEELFHGPTLAFKDYGARFLGRLTGR
FAAEDHRLITVLVATSGDTGSAVASGFHGIANTRVVILYPSGKVSRLQEQQLTTAGGNVH
ALEVRGDFDDCQRLVKEAFVDPELRMRHTLTSANSINIARLIPQSFYYAWATLELKRQYG
LDKPLFSVPSGNYGNLTAGVLAKRMGFPIGHFIAASNTNDSVTRYLEEGRYEPRPTRRTL
STAMDVGNPSNFARLRHFYGDSREAMAADITGISITDKETMETIRNSRERFDYLMDPHTA
VGFAALEKYRMKSGSSCPGVVLSTAHPAKFREAMQDTLQEEVDVPERLASCLNLKKESTL
INPDFRDLSSFLNGLDT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatctacttcagcacaagcaaagcctcgacaccggtctctataaaacgggcaaccctt
gaggggctggcccccgacggcgggctctatgtcccctctgaaatcccgacattttcatcg
ggggagctttcgctgcttgaaagcgccggcttcagcgacattgcgctggccatagctaaa
aaattcatcgaaggggagattccccccgacatcctgcaggatctcgttgcttcatgctac
gatttccccacccccatcatctctcttgacgggtccacctttgttgaggaactgttccat
ggaccgaccctcgccttcaaggattacggagcccgatttctcggccgcctgaccggcaga
ttcgccgccgaggaccaccgcctgattaccgtgcttgtggcaacctccggtgacaccggc
agcgcagtggcatcgggttttcatggtatcgccaacacccgcgtcgtcattctctaccct
tcaggcaaggtaagccgtcttcaggaacagcagctcacaaccgctggcggcaatgttcat
gcgcttgaggttcggggcgactttgacgactgccagaggcttgtcaaagaggcttttgtc
gaccctgaactcaggatgcgccacacactgacctcagccaactccatcaacattgcacga
ctgattccacagtcattttactacgcatgggcaacactggagctgaagcggcagtacggc
ctcgataaacctctcttctccgtaccaagcggaaactatggcaacctcacggcaggcgtc
ctggcaaagaggatgggattccccattggccacttcatagccgcctccaatactaacgac
agcgtgacacgctatcttgaagagggccggtacgagccgcgcccaaccagaaggaccctg
tcaacggccatggatgttggcaacccgagcaatttcgcacgactccgccatttctacggc
gacagccgtgaagcaatggccgctgacattacaggcatcagcatcaccgacaaggagacc
atggaaacaatccgaaactcaagagaacggttcgattatctcatggaccctcataccgca
gtcggctttgcagcccttgaaaagtaccggatgaagagcggaagcagctgccccggagtt
gtcctctccactgcgcacccggcaaaatttcgtgaggcgatgcaggacacccttcaagaa
gaagtggatgttcccgagaggcttgcatcctgtctcaacctcaaaaaagagtcaaccctc
atcaatcccgattttcgcgatctgtcgtccttcctcaacgggcttgacacataa

DBGET integrated database retrieval system