KEGG   Chlorobium phaeovibrioides: Cvib_1697Help
Entry
Cvib_1697         CDS       T00499                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cvib_1697
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cvib_1697
Enzymes [BR:pvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cvib_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1888151..1889299
Genome map
AA seq 382 aa AA seqDB search
MMQLKLTVLLLGALLLPPSIAAAGGSHAADSLSIKIGQMLMVGFRGTTAASSPDIQRAIR
ENHIGGVVLFDYDVPSRSRPRNIVSPEQLAHLTRDLQALSQTPLLIAIDQEGGKVSRLKE
SAGFPPSVTAEYLGSVNNPDTTTTAARRTARTLRSLHITMNLAPVVDLNTNPRNPVIGLL
GRSFSAEADRVTRNAALTLDAFEKEGVLGTLKHFPGHGSSTTDSHLDFTDVSASWSPDEL
LPYRRLIADGFSGAIMTAHVFNATLDPRYPATLSKPTVTGLLRNELGFGGVVLSDDMQMK
AIADHYGLEEAIALAVNAGVDILVFANNTSKYEPHIAGKAAKIIRSLVRKGTISQQQIDA
SFIRVTTLKKQLLPTSQKVRNQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagctgaagcttactgtactccttttaggagccttgctgctgccgccctccata
gcagcagcaggcggcagccatgccgctgacagcctctccattaaaatagggcagatgctc
atggtaggattccggggaacgacagctgcgagttcacccgatatccagcgcgccatcagg
gagaaccacataggaggagtcgtactctttgactatgatgttccgtcccgttcacgcccc
cgcaacatcgtcagccccgaacagctcgctcatcttacccgcgatctgcaggcgctctca
cagacccctcttctcattgccattgatcaggaaggaggaaaagtctcgcgcctcaaagag
tcagcaggcttccccccatcggtaacggcggagtatctggggagcgtcaacaatcccgac
accaccaccaccgctgcccggagaaccgcccgcaccctccgaagcctccatatcaccatg
aatctcgcgccggtggttgatctcaataccaacccccggaatccggtcatcggcctgctc
ggcagaagtttttcggctgaagcggaccgggtgacccgaaatgccgcactgacgcttgat
gcatttgaaaaagagggcgttctcggcaccctcaagcattttcccggtcacgggagctca
acgaccgactcacatcttgactttaccgatgtatccgcctcgtggtcgccggacgagctg
cttccctaccggcgcctcatcgcagatgggttcagtggcgccatcatgacagctcatgtt
ttcaacgccacgcttgacccccgatatcccgccacactctcaaaaccgaccgtgacagga
ttgctccgaaacgaactgggattcggcggagtggttctcagtgacgacatgcagatgaag
gccattgctgaccactacggccttgaggaggccattgcgctggccgtcaatgcgggagtg
gacatcctcgtctttgccaacaacacttcaaaatatgagcctcatattgcagggaaagct
gcaaaaatcatacggtctctggtccggaaaggaaccatatcccaacagcagattgacgca
tcattcattcgcgtcacaacactcaaaaagcagctcctccccacctctcaaaaagtaaga
aaccaatga

DBGET integrated database retrieval system