KEGG   Phaseolus vulgaris (common bean): PHAVU_001G012800gHelp
Entry
PHAVU_001G012800g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    PHAVU_001G012800g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PHAVU_001G012800g
    1.1.1.234  flavanone 4-reductase
     PHAVU_001G012800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 339 aa AA seqDB search
MGSTSESVCVTGASGFIGSWLVMRLMERGYTVRATVRDPENMKKVKHLVELPGAKTKLSL
WKADLAEEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIKGLVDIMKACVKAKSV
RRIVFTSSAGTVDVAEKSKPFYDENCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKE
HNIDFVSIIPPLVVGPFLMPTMPPSLITALSLITGNEGHYHIIKQGQFVHLDDLCLAHIF
LFENPKAEGRYICCSHEATIHDIAKLLNQKYPHYNIPTKFKDIPDELEIIRFSSKKITDM
GFKFEYSLEDMFAGAVETCREKGLLPQPAQTPVNGTMHK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaacttccgaatccgtttgcgtcaccggagcttctggtttcataggatcatgg
cttgtcatgaggctaatggagcgtggctacaccgttcgagccaccgtacgcgacccagaa
aacatgaagaaggtgaagcatttggtggaacttccaggtgcaaagacgaaactgtctcta
tggaaagctgaccttgctgaagagggaagctttgacgaagccattaaaggctgcacagga
gttttccacgtcgcaacccccatggatttcgagtccaaggaccctgagaatgaagtgata
aagcctacaataaaggggttagtggatatcatgaaagcatgcgtgaaggccaaaagtgtg
agaaggattgtcttcacatcctcagctggaactgtggatgttgccgagaagtcaaagcct
ttttatgatgagaactgttggagtgatgttgagttctgcagaagggtcaaaatgactggt
tggatgtattttgtttcaaagacactggcggagaaagaagcttggaaatttgccaaagag
cataacatagactttgtctcaatcattccacctcttgttgttggtccttttctcatgcct
acaatgccaccaagcctaatcactgctctttcactcatcacaggaaatgaagggcattac
catatcataaagcaaggccagttcgtgcacttagatgacctttgtcttgctcatatattt
ttgttcgagaatccaaaagcagaagggaggtacatatgctgttcgcatgaggctaccatt
catgacattgcaaaactgctgaaccagaaataccctcactataatatccccacaaagttc
aaggatattccagatgaattggaaattattagattttcttcgaagaagatcacagacatg
ggcttcaagtttgagtacagcttagaggatatgttcgcaggagctgttgagacctgcaga
gaaaaagggcttcttcctcaacctgctcaaactcctgttaatggcaccatgcacaaatag

DBGET integrated database retrieval system