KEGG   Phaseolus vulgaris (common bean): PHAVU_005G095300gHelp
Entry
PHAVU_005G095300g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHAVU_005G095300g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHAVU_005G095300g
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHAVU_005G095300g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PHAVU_005G095300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 966 aa AA seqDB search
MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC
YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK
LLKKGDFADENSAMTESDIEETLKRLVTQLKKTPQEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANMYFSQIEDLMFELSMWRCTDELRVRAHELHRSSKRDAKHYIEFWKQI
PPNEPYRVILGDVRDKLYNTRERARQLLASGNSDIPEETTFTKIEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVMDAITKHLGIGSYREWSEEK
RQQWLLSELSGKRPLFGHDLPKTEEINDVLETFHVISELPKDNFGAYIISMATAPSDVLA
VELLQRECHVKEPLRVVPLFEKLADLETAPASVARLFSIDWYRDRINGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELVKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTVH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPESPKPAWRALMDEMAVIAT
QEYRSVVFREPRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGTAFKHVIEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALFD
KLLVPEELRPFGESLRAKYEETKTFLLQVAGHKDLLEGDPYLKQRLRLRDSYITTLNVLQ
AYTLKRIRDPDYHVKLRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggctacccgtaacattgagaagatggcctccattgatgctcagttgaggttgctggca
ccacgcaaggtctctgatgatgacaaactggttgagtatgatgctcttttgttggaccgt
ttccttgacattctgcaggatttgcatggtgaagatatcagacaaacggttcaagattgt
tatgagctgtcggctgagtacgaaggggagcatcgacctgaaaagttggaggaacttggg
aatatgctgactggtcttgatgctggggattcaattgttatttccaaatccttttctcac
atgctcaatttggccaacttggcagaagaagttcaaattgcgtaccgaagaaggatcaag
ttattgaagaagggtgattttgcggatgagaactctgccatgacagagtcagacattgaa
gagaccttgaagaggctcgtgactcaactgaagaagaccccccaggaagtctttgatgct
ctgaagaaccaaactgtggatttggtcctaactgctcatcctactcagtctgttcgcaga
tctttgctgcaaaagcatggaaggataaggaattgtttgacacaattatatgccaaagac
ataactccagatgacaagcaggaacttgatgaggctttacaaagagagattcaagctgca
tttcgcacagatgaaattcgacggactcctcctacaccacaagatgagatgagggcagga
atgagctactttcatgagacaatttggaaaggtgtaccaaagtttctgcgccgggttgat
acagctctgaagaacattggaataaacgaacgtgtcccatataatgctcctgttattcag
ttctcttcttggatgggaggagatcgtgatggtaatccaagagtaacccctgaagttaca
agggatgtgtgtttgctggctagaatgatggctgctaatatgtacttctctcagatagag
gatctcatgtttgagttgtctatgtggcgttgcactgacgagctccgtgttcgtgctcat
gaactccataggtcctcaaagagagatgcaaaacattacatagaattttggaaacagatt
cctccaaatgagccatatcgtgttattcttggtgatgtaagagacaaactgtataacaca
cgtgaacgtgctcgccagttattagccagtgggaactctgatatcccagaggagacaacc
ttcactaaaattgagcagttcctggagcctcttgaactgtgctataggtcactatgtgca
tgtggtgacagaccaatagcagatggaagcctccttgatttcctgcggcaagtttccaca
tttggactctcacttgtgaggcttgacatccgtcaagagtcagaaaggcacactgatgtt
atggatgctatcacaaaacacttgggaattggatcataccgagagtggtctgaggaaaag
aggcagcagtggctcttgtctgaactcagtggaaaacgccctctctttggccatgacctt
cccaaaacagaagaaatcaatgatgttttggaaaccttccatgtcatttcagagctacct
aaagacaactttggtgcctacatcatatcaatggccactgccccatctgatgtgctggcg
gttgagcttttacaacgtgagtgccatgtgaaggagccactaagggtggtgccactgttt
gaaaagcttgctgatcttgagactgctccggcttccgtggcacgacttttctccatagat
tggtacagagaccgcatcaatgggaagcaagaagttatgatagggtactcagactcagga
aaagatgctggccgtctttcagctgcttgggcgctttacaaggctcaagaggaacttgtg
aaggttgctaaggactttggcgtgaagcttacaatgtttcatgggagaggagggactgtt
ggaagaggaggaggaccaacccatcttgctattttgtctcagccaccagacaccgttcat
ggctcacttcgggtaacggttcagggagaagtcattgaacagtcttttggagaggagcat
ttgtgctttaggacacttcaaaggttcactgcagctacgcttgagcatggcatgcatcct
cctgagtcaccaaaaccggcatggcgcgccctcatggatgagatggctgtcattgctact
caggagtatcgctctgttgttttcagagagcctcgttttgttgaatatttcagacgtgca
actcctgagttggagtatggaagaatgaacattggcagtcgtccatcaaagcgaaagcca
agcggaggaattgaatcgctacgtgctattccttggatttttgcatggacacaaacaagg
tttcatttgccagtgtggcttggttttgggacagcctttaagcatgttattgagaaagat
ccaaagaatctgcaaatgcttcaggatatgtacaaccaatggcctttctttagggtcacc
cttgacttggttgagatggtgtttgccaagggagaccccggcattgcagccctatttgac
aaactccttgtgccagaagagctacgtccatttggagagagcttacgagctaaatacgaa
gaaaccaaaacttttctcctccaggttgctgggcacaaggatcttcttgaaggagacccc
tacttgaagcaaagacttcgacttcgtgactcatacatcacaaccctgaatgtgttgcaa
gcctacacgttgaagcgaatccgtgatcctgactaccatgtgaagttgaggccacacttg
tcaaaggactacatggaatcaagcaagccagcagcagagcttgttaaacttaaccccaaa
agcgagtatgcacctggccttgaagacacccttattttgacaatgaagggtattgctgct
ggcatgcaaaataccggttga

DBGET integrated database retrieval system