KEGG   Phaseolus vulgaris (common bean): PHAVU_007G134300gHelp
Entry
PHAVU_007G134300g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHAVU_007G134300g
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PHAVU_007G134300g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PHAVU_007G134300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 955 aa AA seqDB search
MVSGNIFHCRKSSWPPEEYISKSTLLLFDYDSSAPPEQAWRRRLNSHANLLKEFRVTFME
AIKMVRLGIRIWSYVREEASHGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FRQWQIIPSLCEASPVMANQFSIFISREGGNKKFSSVLAPGQHEGLGSTRKPDDQGISSW
GWNLSGQHSTYHALFPRAWTVYDGEPDPELKISCRQISPFVPHNYRESSLPAAVFVYTLV
NAGKERAKVSLLFTWANSIGGSSHLSGDHVNEPFQTEDGVSGVLLYHKTAKGNPPVTFSI
AACETQNVSVSVLPSFGLSEGSSITAKGMWSKMVKDGQFDQENFNSGPSMPSSPGETLCA
AVAASAWVEPHGKCTVAFSLAWSSPKVKFVKGCTFNRRYTKFYGTSDKAAVDLAHDALTH
YSRWEEEIEKWQNPILKDETLPEWYKFTLFNELYFLVAGGTIWIDSPLLSSSMPNDQDQV
RELENAGVKETEDKINGRKRTVVMRTTDSTYESTTSTGHNCVDEKLYGHDNDDDVGRFLY
LEGVEYIMWCTYDVHFYASFALLELFPRIELNIQRDFARAVLCEDGRKVKFLAEGNWGIR
KVYGAVPHDLGTHDPWYEMNAYNIHDTSKWKDLNPKFVLQVYRDFAATGDLQFGIDVWPA
VRAAMEYMDQFDRDRDGLIENDGFPDQTYDTWTVHGVSTYCGCLWLAALQAAAAMALELG
DRDFAEICKRKFLKAKPAFEEKLWNGSYFNYDSGSSGNSKSIQADQLAGQWYTASSGLPS
LFEDFKIKSALRKVYDFNVMKVKGGRMGAVNGMHPNGKVDDTCMQSREVWTGVTYGVAAT
MILAGMEEEAFTTAEGIFLAGWSEDGYGYWFQTPEAWTMDGHYRSLMYMRPLAIWGMQYA
RNRPKAILEAPKINIMDRIHLSPVIGGFSHHNETGVRKIATKARCFSNSVFHCAC
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggttagcggcaacatttttcattgtagaaaaagttcgtggcctccggaagagtatatc
agtaaatccactctgctgctgtttgattatgatagttctgctccccctgagcaagcttgg
agaaggagattgaacagccatgccaatcttcttaaagaatttagagtaacttttatggaa
gctataaaaatggttcgattagggatacgtatttggtcatatgttagggaagaggcttct
catggaaggaaagcacctattgatcctttcactcgcgagagttgcaagccatctgcatct
caaggagttccacttggtgggatggggagtggtagcatatcaagaggatttagaggtgag
ttccgacaatggcaaattattcctagcttatgtgaagcgtcaccagtcatggccaatcag
ttctctatttttataagtagagagggaggaaacaaaaaattttcgtcagttttggctcct
ggccagcatgaaggtttaggatctaccaggaaacctgatgatcagggcatatcatcatgg
ggatggaatctaagtgggcagcactcaacctaccatgctttgtttccaagagcttggaca
gtttatgatggtgagcctgacccagaactaaaaatatcttgtcggcagatatccccattc
gtaccacataattatagagaaagcagtctacctgctgctgtttttgtttatacgttggtg
aacgcaggtaaggaaagagctaaagtcagccttttatttacttgggcgaattccattggt
ggaagctcacacctgtcaggagatcatgtgaatgaaccattccaaactgaagatggagtc
tccggtgtacttctatatcacaagacagcaaaaggaaaccctcctgttactttttccata
gcagcatgtgaaacacagaatgttagtgtttctgttttgccaagttttgggctgtctgaa
ggaagtagcataacagcaaaaggcatgtggagtaaaatggtgaaggatgggcaatttgac
caggagaatttcaattctggacctagcatgccctcatcacctggagagacactatgtgct
gctgttgcagcttccgcttgggttgaaccccatggaaaatgcaccgttgcatttagtctt
gcatggtcatctccaaaagtaaagttcgtgaaaggttgcactttcaataggagatataca
aaattttatgggacttctgataaagctgcagtggacttggcccatgatgctttgactcat
tacagtcggtgggaagaagagattgagaaatggcagaatcctattctcaaggatgagaca
ctaccagaatggtacaaatttacattatttaatgaactctactttcttgttgccggagga
acaatttggattgactctcctttgctatcttcaagtatgccgaatgaccaagatcaggtg
agggagttggaaaatgcaggcgtcaaagaaactgaagataaaataaatggcagaaaaagg
acagttgtgatgcgtacaactgatagtacctatgaatctaccactagtacaggacataat
tgtgtggatgaaaagctatatggacatgataatgatgatgatgttggaaggttcttgtac
ttggaaggagtggaatatatcatgtggtgcacatatgacgtgcacttctatgcatcattt
gctcttctagagctctttcctaggattgaattaaatatacagcgtgactttgctagagct
gtcttgtgtgaagatggaagaaaagtaaagtttttggcagagggaaattggggaattcgc
aaggtttatggggcagtgccacatgatctggggacacacgatccgtggtatgaaatgaat
gcctataacatccatgatactagcaagtggaaggacctgaacccaaaatttgttctccag
gtgtatcgagattttgctgcaacaggtgatttgcaatttggaattgatgtgtggcctgct
gtccgggctgcaatggagtacatggaccaatttgacagagatcgcgatggtcttattgag
aatgatgggttccctgatcaaacatatgatacatggacagtccatggtgtgagcacatac
tgcggatgtctttggcttgctgctctacaagctgccgcagcaatggcccttgaactgggt
gacagagattttgcggaaatatgcaaaagaaagtttttgaaggctaagccagcatttgaa
gaaaaactgtggaatggttcatattttaactacgacagtggatcaagtggtaacagtaaa
tccattcaagcagatcaattggctgggcaatggtatactgcatcctcagggcttccctcc
ctttttgaggattttaaaatcaaaagtgctctccggaaggtttatgatttcaatgtaatg
aaagttaaaggaggtaggatgggtgctgtaaatggcatgcatcccaacggtaaggttgat
gacacctgtatgcagtctcgtgaagtatggacaggtgtgacctatggagttgctgcaaca
atgatacttgctggaatggaagaagaggccttcacaacagccgagggaatatttctagcc
ggctggtcagaagatggatatgggtactggtttcagactccagaggcatggacaatggat
gggcactaccggtccctcatgtacatgaggcccctggccatttggggtatgcaatatgca
aggaatcggcccaaggcaattcttgaggcccctaaaatcaatatcatggacagaatccac
ttgtctcctgttattggcggattctctcatcataatgaaacaggtgtgagaaagattgca
acaaaagcaagatgttttagcaattctgtgtttcattgtgcttgctga

DBGET integrated database retrieval system