KEGG   Phaseolus vulgaris (common bean): PHAVU_007G246200gHelp
Entry
PHAVU_007G246200g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K13082  bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00941  Flavonoid biosynthesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Module
pvu_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    PHAVU_007G246200g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     PHAVU_007G246200g
    1.1.1.234  flavanone 4-reductase
     PHAVU_007G246200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA adh_short Polysacc_synt_2 KR
Motif
Other DBs
NCBI-GeneID: 18626941
NCBI-ProteinID: XP_007145529
UniProt: V7BKG5
Position
7
AA seq 329 aa AA seqDB search
MGSESLTVCVTGASGFIGSWLVMSLIQRGYTVRATVIDPDDTKEVKHLLEIGGAKSKLSL
WKANLEEEGSFDEAIKGCIGVFHLATPINFESKDPENEVIKPAIRGVIDIMKACLKAKSV
RRLVFTSSAITTQISHHQKPLYDETCWTDVELCRAAKMTGWMYFVSKTLAEQEAWKFAKE
KGMDFVTILPTLVVGPFLLPSMPSSLITALSPITGKEQHYSIIRQGQLVHVEDVCRAHIF
LFEEPKAEGRYICNACDVTIHHIAKLINKKYPEYKVPTRFEKIPDELELVRLSSKKIREL
GFKFKYSLEDMYTEAIDACKEKGFLPKHA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagaatccttaaccgtttgcgttacaggggcttctggtttcatcggatcatgg
cttgtcatgtcactcatccaacgtggctatactgttcgagccactgttattgacccagat
gatacgaaggaggtgaagcatttgctggagataggaggtgcaaagagcaagctttcactg
tggaaggctaaccttgaagaagagggaagctttgatgaagccattaaagggtgcattgga
gttttccacttggccacccccattaactttgaatccaaagaccctgagaatgaagtgata
aagcctgcaataaggggagtaatagatatcatgaaagcatgcttgaaggcaaaaagtgtg
agaaggcttgtattcacatcctcagccataaccacccaaatttctcatcaccaaaagcct
ctgtatgatgagacctgttggactgatgttgagttatgcagagcagccaagatgactggt
tggatgtatttcgtttccaaaactctggcagagcaagaagcatggaaatttgccaaagaa
aaaggaatggactttgtcactatccttccaactctcgttgttggcccttttctgctccca
tcaatgccatctagcttaatcactgcactttcccctatcacaggaaaagagcagcattat
tcgatcataagacaaggtcaattggtgcacgtagaagatgtttgtcgtgctcatatattt
ctatttgaagagccaaaagctgaaggaagatacatatgcaatgcatgtgatgtcactatt
catcacattgcaaaattaattaacaaaaaatacccagaatacaaggttccaactaggttt
gagaagattcctgatgaattggagttggtgaggttatcttccaagaaaataagagagttg
ggattcaaattcaaatacagcttggaggatatgtatacagaagcaattgatgcatgcaaa
gaaaaagggtttcttcctaaacatgcttag

DBGET integrated database retrieval system