KEGG   Phaseolus vulgaris (common bean): PHAVU_008G108600gHelp
Entry
PHAVU_008G108600g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    PHAVU_008G108600g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PHAVU_008G108600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 261 aa AA seqDB search
MMIQDDSSLFHSSLVALFLMAPPTFLSLTFLQAPYGKHHRPGWGPNLPPPLAWLLMESPT
LWLTLLLFPHGLHSDNPKAQALIAIFLLHYFNRTILYPLRLLFTPSKKTASGFPLSVALM
AFFFNLLNSYLQARSVSHYHTHYTSSGFFWFRFLIGLLVFLCGMGINVWADRVLLRLKSE
GKGYVVPRGGLFDLVACPNYFGEIVEWLGWAVMTWSWAGLGFFLYTFANLGPRARGNRRW
YLEKFGEDYPKQRKGVIPFLY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatgatccaagacgactcctccctcttccactcttccctcgtcgcgctcttcctcatg
gcaccccccaccttcctctccctcaccttcctccaggccccctacggcaagcaccacagg
cccggatgggggcccaacctcccgccccccctcgcctggctcctaatggaaagcccaacg
ctctggctcaccctcctcctcttcccccatggcctccactccgacaaccctaaagcccaa
gccctcatcgccatcttcctcctccactacttcaaccgcaccatcctctaccctctccgc
ctccttttcaccccgtccaaaaaaaccgcatcgggcttccccctctccgtggccctcatg
gccttcttcttcaacctcctcaattcctatctccaggcccgttcagtctcccactaccac
acccattatacttcatcgggctttttctggttccggtttttgattgggcttttggtgttt
ttgtgtgggatggggattaatgtgtgggctgatagggttttgctgcggctgaagagcgag
gggaagggctacgtggtgccccgcggagggttgttcgacctcgttgcgtgtcctaattac
tttggggagattgtggaatggctgggctgggctgttatgacttggtcctgggctgggctg
ggcttttttctttatacttttgcgaacctcgggcccagggcgcgtggcaaccggaggtgg
tatttggaaaagtttggggaggattatccgaagcaaaggaagggtgttattccattcttg
tattga

DBGET integrated database retrieval system