KEGG   Phaseolus vulgaris (common bean): PHAVU_008G212600gHelp
Entry
PHAVU_008G212600g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHAVU_008G212600g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PHAVU_008G212600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 462 aa AA seqDB search
MGIDQRRWRWWNAVVLIGMVSVTVTVTSSDSHEKQEQEVSRIAFGSCSNQNAPQPIWDAV
VDFRPQIFIWLGDNIYGDFKRPFKIFGRERTVGPWKNVPRFVPSSEQEMKARYEKAKSSP
GYVRLHQNAKVIGTWDDHDYGLNDAGKEFQGKITNQKLLLDFLDEPQDSPRRKQAGVYAS
YTYGPVGRDIKIVLLDTRYHRDPVGSDGTILGNSQWLWLEKELKGPATALTIIGSSIQVI
SNLSATIHPLFAMESWGRFPKERDRIFKLIADSKRAGVFFISGDVHFGEITRYDCAVGYP
LYDVTSSGVTQSVEEVVPPFLRSFVRFVALLTPSTMRVKGQHCRYKSCIYGRPNFGTIEI
DWDSHPVTLKLKVRDKESITVTGVDVSLTELQLSNSESFDRAKAGHDNQKHCTLEVSLPW
FVRYRLAILFCCTLIVFHVAFLALVYTCFRLFRLEGCKRKHD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgatcaacgtcggtggcggtggtggaacgccgtcgttttgatcggaatggtc
agcgttacagtaaccgttaccagttccgacagtcacgagaagcaggaacaagaagtctct
cgaattgccttcggatcatgctccaaccagaacgctccacagcccatttgggatgcagtg
gtggatttccgtccccaaatttttatatggctgggtgataacatttacggggacttcaaa
cgccctttcaaaatatttggacgggaaaggactgttgggccgtggaagaatgttccacga
tttgttccttcctctgagcaggaaatgaaggctagatatgaaaaggctaagtctagtcct
ggatatgttcgacttcatcagaatgctaaggtaatcggtacatgggatgatcacgattat
ggattaaatgacgcaggaaaagaatttcaaggaaaaatcactaaccagaagttgcttctt
gatttcttggatgaacctcaagatagcccacggcggaaacaggctggtgtatatgcctca
tatacgtatggtcctgtaggtagagatatcaagattgtactcttagatactagatatcac
agagaccctgtaggaagtgatggtaccattttggggaattcacagtggttgtggttggag
aaagagctcaagggtccagcaacggctcttaccataattggatcttctattcaggttata
tcaaatctttcagcaaccattcatccgttgtttgcaatggagtcatggggtcgttttcca
aaggaaagagaccggatttttaaattaatagctgatagtaagagagctggagtatttttt
attagtggagatgttcactttggggaaatcacgagatatgattgtgctgtgggctatcca
ctatatgatgtaacctcaagtggggttactcaatcagttgaggaagttgtcccaccgttc
ctgcgttcttttgtgagatttgtagcattgttgaccccatctacaatgagagtaaagggc
cagcactgcagatacaaatcttgtatatatggtcggccaaactttggaactattgaaata
gattgggactctcacccagtgactctgaaactaaaagtcagggataaagagagcatcacg
gttacaggtgttgatgtttcattgacggaattgcaattatcaaattcagagagttttgac
agagcaaaagcaggacatgataatcagaagcattgcacccttgaagttagtctgccatgg
tttgtaagatatcgcctggcgatcctgttctgttgcaccttaattgtgtttcatgttgcc
ttcctagcgctagtttacacttgcttcagacttttcagactagaaggctgcaaaagaaag
cacgattga

DBGET integrated database retrieval system