KEGG   Phaseolus vulgaris (common bean): PHAVU_010G017600gHelp
Entry
PHAVU_010G017600g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHAVU_010G017600g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PHAVU_010G017600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 420 aa AA seqDB search
MHSFSRLSIFCLFISLSPLFSSSALLFQGFNWESSKKGGWYNSLKNSVPDIANAGITHVW
LPPPSQSVSPEGYLPGRLYDLDASRYGSKDELKSLIAAFHEKGIKCLADIVINHRTAERK
DGRGIYCIFEGGTPDARLDWGPSFICKDDTTYSDGTGNNDSGESYDAAPDIDHLNPQVQR
ELSEWMNWLKTEVGFDGWRFDFVKGYAPSISKIYMEQTRPDFAVGEKWDPLSYENGKPTY
NQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPSGMIGVKPENA
VTFIDNHDTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIR
VRNGINEKSTVEIMAAEGDLYVAKIDNKIMVKIGPKMDLGKLIPSNFHVATSGQDYAVWE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcattccttctctcggctcagcatcttttgtctcttcatttcactctctcctcttttc
tcttcctctgccttgctgtttcagggattcaactgggaatcaagtaagaaagggggttgg
tacaactcgctgaagaactcggttcctgacattgcaaatgcaggaattactcatgtgtgg
ctccctcctccctctcaatctgtttctcctgaagggtatcttccaggaaggctatatgat
cttgatgcatcaaggtatggatccaaggatgaactgaagtccctaattgctgcttttcat
gagaaggggatcaagtgcctggctgacatagtgatcaaccacagaactgcagagaggaaa
gatggaagaggaatatattgtatctttgaaggtggtactccagatgcacgccttgattgg
ggtccatctttcatttgcaaagatgacactacttattctgatggcactggaaacaatgac
agtggagagagctatgatgctgcacctgacattgaccatctcaatccgcaggtgcaaaga
gagttgtctgaatggatgaattggctcaaaactgaggttggttttgatggatggaggttt
gattttgtgaagggctatgcccctagcatttccaagatctatatggaacaaactaggcca
gattttgcagtaggagagaaatgggatcctctctcatatgagaatgggaagcctacctat
aaccaagatagccatcgtggggcactggtgaattgggttgaatctgcaggtggggctatt
actgcctttgatttcacaaccaaaggaattcttcaagctgctgtgcaaggggagctgtgg
aggttgattgatccaaatggcaagccttctggaatgattggtgtgaaaccagaaaatgca
gttacctttattgacaaccatgacactggttccacacagagactttggccattcccttct
gacaaagtcatgcaaggatatgcctacattctaacacaccctggcaccccctcaatattc
tacgaccatttctttgattggggtttgaaggaacagattgccaaattgagtagcataagg
gtgaggaatgggatcaatgagaaaagcactgtggaaattatggcagctgaaggtgacctt
tatgttgcaaagatagacaacaagatcatggtgaagatagggccaaagatggaccttgga
aaacttattccctcaaatttccatgttgctacctctggccaagactatgccgtgtgggag
tga

DBGET integrated database retrieval system