KEGG   Phaseolus vulgaris (common bean): PHAVU_010G137900gHelp
Entry
PHAVU_010G137900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHAVU_010G137900g
   00500 Starch and sucrose metabolism
    PHAVU_010G137900g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PHAVU_010G137900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 562 aa AA seqDB search
MTMFISTISLFTLFSALCATPSAHPHTSSSHHSYDQPYRTAYHFQPPKNWINDPNGPLRF
GGLYHLFYQYNPKGAVWGNIVWAHSVSKDLVNWTPLEPAIFPSQPSDIKGCWSGSATVLP
GNKPAILYTGINQLNQQVQNLAMPKNLSDPFLREWVKSPKNPKMAPTSANKINSSSFRDP
TTAWLGQDGDWRVLVGSKRGTRGMALLYRSKDFLDWDEVKHPLHSTLGSGMWECPDFFPV
LKNGQKGVDTSVNGDHVRHVLKASLDDKKHDYYMIGSYNAAKDKFIPDKVFDDFIIRYDF
GKYYASKTFFDDGKKRRVLLGWVNESSSVADDIKKGWSGIHTIPRAIWLHKSGKQLVQWP
VEEIEKLRAKPVKLAPQDLKGGNLLQINGVTATQADVEVSFEVSELRKAERLKYWIDPQI
LCSRKGSSLRSGLGPFGLLVFASEGLQEFTSVFFRIFRYQHKYLVFLCSDQSRSSLNKNN
DLTTYGTFVDVDPLKEKLSLRTLIDHSVVESFGGEGRGCITARVYPTLAINDKAKIYVFN
NGTSEVKITRLHAWSMKKAHIK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactatgttcatctctaccatttctctgttcactcttttttctgccctttgtgccact
ccatctgctcatcctcacacttcatcttctcatcattcttatgatcaaccttacagaact
gcttatcacttccaacctcccaagaattggataaatgatcccaatggaccattgcgattt
ggaggactttatcatttgttctatcagtacaatcctaaaggtgctgtttggggaaacatt
gtgtgggcacattcagtgtcaaaggatcttgtgaactggaccccactagaacctgccatc
ttcccatctcagccgtctgatataaaaggttgttggtcaggatcagccacagtgcttcct
ggtaacaaaccagccattttatacactggaattaaccaactgaatcaacaagtccaaaac
ttggccatgcccaaaaatttgtctgacccttttctcagggaatgggttaagtcccccaag
aaccctaaaatggcaccaacaagtgctaataagatcaattcaagttcatttagggatccc
actactgcatggctagggcaagatggagattggagggtacttgtaggaagcaaaagagga
actaggggaatggcccttttgtataggagcaaagattttcttgattgggatgaagtcaaa
caccctttgcattcaaccctaggcagtggaatgtgggagtgccctgattttttcccagtt
ttgaagaatggccaaaagggtgttgacacatctgtgaatggtgatcatgttaggcacgtg
ctgaaggctagtttggatgacaaaaaacatgattactacatgatagggagttacaatgct
gccaaagataagtttatcccagataaagtgtttgatgattttattatcagatatgatttt
ggaaaatactatgcctcaaaaaccttctttgatgatggaaagaagagaagggttttgctt
gggtgggtgaacgaatcatcaagtgttgctgatgatatcaagaagggatggtctggaatc
catacaattccaagggctatttggctgcataagtctggtaaacagctggtgcagtggcca
gtggaagaaattgaaaagctaagagcaaaaccagtgaagttggcaccccaagacttaaaa
ggaggcaacttgcttcaaattaatggtgtcacagcaacacaggctgatgttgaagtttca
tttgaagtgagtgaattgagaaaggctgaaagattgaagtattggattgaccctcaaatc
ctatgtagcagaaagggttcatccctcagaagtggattgggtccttttggtttgctggtt
tttgcttcagagggattgcaagagttcacatcagttttcttcagaatattcagataccaa
cacaaatatttggtgttcttgtgcagtgatcagagcaggtcttccttgaacaagaacaat
gatttgaccacttatggaacttttgttgacgtggatcctcttaaggagaagctgtcattg
agaaccttgattgatcattcagtggtagagagttttggaggagaaggaagagggtgcatc
actgcaagagtttatcctacattagcaataaatgataaagcaaaaatatatgtttttaac
aatggtacttcagaggtcaagattacaagattgcatgcttggagtatgaagaaagctcat
attaagtaa

DBGET integrated database retrieval system