KEGG   Phaseolus vulgaris (common bean): PHAVU_010G156200gHelp
Entry
PHAVU_010G156200g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PHAVU_010G156200g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PHAVU_010G156200g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PHAVU_010G156200g
Lipid biosynthesis proteins [BR:pvu01004]
 Desaturase
  First
   PHAVU_010G156200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 425 aa AA seqDB search
MVLFGHLHLHVTINLTTLKPKPIIPTTPPSTKIIQFPCFHSMALITTQPKNPIFHRCTTL
HRSIPRRDNSTTVLGLGSIKNFSFDQKQSKISLKNNPFCYNLAVTAKATANAAFGGGLEA
EGSLKHRRILLSEVEVKRERSVFFGRKWNSLDVGTAGMVLVMHVLCLFAPFHFNWPAFWV
AVALYVVTGLFGITLSFHRNLSHRSFKLPKWLEYFFAYCGALALQGNPIDWVSTHRYHHQ
FCDSERDPHSPTEGFWFSHMSWLFDTNSIIERCGEPNNVVDLEKQPFYRLLRSTYLVHPF
ALGTLLYAAGGFPFLVWGMGVRIVWVYHITWFVNSACHVWGNQAWNTRDLSRNNWWVALL
AFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAVGLATEVKLPTESQKQRMAFNS
DTITT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtttggtcacttgcacttgcacgtcacaatcaacctcaccacgttaaaaccc
aaaccaattatccccacaacaccaccttccacaaaaatcattcaattcccttgcttccat
tccatggctctcatcaccacccaacctaaaaaccccattttccaccgctgcaccaccctt
caccgctcaattccacggcgggataatagtactactgttcttggtcttgggtccattaaa
aacttcagctttgaccaaaaacaaagcaaaatctcccttaaaaacaaccccttttgctat
aatttggcagtgacggccaaagccacggccaatgcagcatttggagggggtttggaggca
gaggggtcactgaaacacagaaggattttgttgtctgaagttgaggtgaagagagagagg
agtgttttctttgggaggaaatggaactctttagatgttggcactgctggaatggtgttg
gtcatgcatgtgctttgcctctttgctccattccacttcaattggccagctttttgggtg
gctgtggctctctacgttgtcactggcctttttggcatcactctttctttccacaggaac
ctttctcataggagtttcaagcttcccaaatggcttgaatatttctttgcctattgtggg
gctctggcacttcagggaaacccaatagattgggtaagcacacatagataccatcaccag
ttttgtgattctgagagagaccctcatagccccactgaagggttctggttcagccatatg
agctggctctttgatactaattctatcattgaaaggtgtggagagccaaataatgttgtt
gatttagagaaacaacctttttatagacttctccgaagcacttaccttgtccaccctttt
gctttgggaacccttctatatgcagcaggaggatttcctttcctagtttggggaatggga
gtgaggattgtttgggtttatcacataacctggtttgtaaactcagcttgccatgtatgg
gggaatcaggcctggaacaccagggacttgtccagaaataattggtgggtggcattgctt
gcatttggtgaaggttggcacaataaccaccatgcttttgagtattcagctcgacatgga
ctagagtggtggcaactagacatgacttggtacgttgtgagatttctccaagctgttggg
ttggccactgaagtcaagttacccacagagagtcagaagcagagaatggcattcaatagt
gatacaataaccacatga

DBGET integrated database retrieval system