KEGG   Phaseolus vulgaris (common bean): PHAVU_011G005900gHelp
Entry
PHAVU_011G005900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00052  Galactose metabolism
pvu00500  Starch and sucrose metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHAVU_011G005900g
   00500 Starch and sucrose metabolism
    PHAVU_011G005900g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PHAVU_011G005900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 18614750
NCBI-ProteinID: XP_007131343
UniProt: V7ACU0
Position
11
AA seq 627 aa AA seqDB search
MKKTKTKTMNPDSQIPLLIPPTSPTMESGGRPQKGTLLFIVSVLFLMPLAALFISLHIHN
LQKAFRREENSLPLFPRGVAEGVSAKSNPYLWQKGSYNWTNAMLSWQRTAFHFQPQKNWM
NDPNGPLFYKGWYHIFYQYNPESAVFGNITWGHAVSTDLIHWLYLPIAMLRDSWYDAKGV
WSGSATLLPDGRIVMLYTGNTHQNVQVQNLAYPANLSDPLLLHWVKYADNPVVLPPPGIG
PKDFRDPTTAWVGPDDKWRVLIGSKVNQTGLSLVYKTQDFIHYELNDEYMHEVPGTGMWE
CVDFYPVSVNGPDGLDTSVNGPGVKHVLKSSLDDTRGDHYAIGRYFIENDTWVPDDPNKD
VGIGLKLDYGRFYASKTFYDQNKKRRVLWGWINESDSETADLKKGWASLQSIPRTVVFDK
KTETHLLQWPVEEIESLRLRSYEFEEVVVKPGSVVPLDIGPATQLDIFAEFEIEYLASKG
TGKKENVGCGNGAFDRSSLGPFGILAIADDKLSELTPIYFHLSNTSFFCVDETRSSKASD
VSKLVFGSEVPVVGDERLSMRVLVDHSIIESFAQGGRTVISSRVYPTEAIYEAARLFVFN
NATDINIKASLKIWQLNSAFIRPFPFH
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacaaagacaaagacaatgaaccctgattcacaaattccattgctgattcct
ccaacttccccaacaatggaaagtggaggaagaccacaaaagggtacccttcttttcatt
gtttcagtgctttttctcatgccattggctgcactcttcataagcctgcatatccataat
cttcagaaggctttcagaagggaggaaaattccctgccattgtttcccagaggtgttgca
gaaggagtttcagccaagtcaaatccttatctgtggcagaaaggttcatataattggaca
aatgccatgctatcgtggcaaagaacagcttttcattttcaacctcaaaaaaactggatg
aacgatcctaatggtccattgttttacaaggggtggtaccatatattttaccaatacaat
cctgagtcagctgtgtttggcaacataacgtggggccacgctgtatcaacggacttgatt
cactggctctaccttcccattgcgatgcttcgagattcctggtatgatgcaaaaggtgta
tggtcaggatcagccacgcttttgccagatggcagaatcgtaatgctctacaccggtaac
actcatcagaacgtgcaagtccaaaatcttgcgtaccccgccaacctatccgatcccctc
ctccttcattgggtcaaatacgcggataacccggttgtgttgcccccaccaggaattggg
ccgaaggattttcgtgacccaacaacggcgtgggttgggccagatgacaaatggagggtc
cttattgggtcaaaggtgaaccagacagggctttcgttggtgtataaaacccaagatttc
atccactacgaactcaatgatgagtatatgcatgaagttccgggtacgggtatgtgggag
tgcgtggacttttacccggtttcggtaaatgggcctgatgggctggatacatccgtaaat
gggccgggtgtgaaacatgtgttgaagtccagtttggatgacactaggggggatcattat
gcgattgggaggtacttcattgaaaatgatacatgggtgcccgatgacccgaataaggat
gtgggtatcgggttgaagttggactatggaagattctatgcgtcaaagacattttatgac
caaaacaaaaagagaagggtcctgtggggttggatcaacgaatcagacagcgaaaccgct
gacctcaaaaagggttgggcatctcttcagagtattccaagaacagtggtgtttgacaag
aagactgaaactcatttgcttcagtggccagtggaagaaatagagagcttaaggcttaga
agttatgaatttgaagaagttgtggttaagcctggttcagttgtaccactggacataggc
ccagccacacagttggacatatttgctgaattcgaaatcgaatatttagcatcgaaaggt
accgggaagaaggaaaatgtagggtgtggaaatggagcttttgacagaagtagtttggga
ccatttggcattctggctattgcagatgacaaactttctgagctgacaccaatttatttc
catctttctaacacatctttcttctgtgttgatgaaaccagatcttcaaaggcttctgat
gtttcaaaactcgtttttggaagcgaagtaccagtggtcggcgatgaaagattatcgatg
agagtattggtggaccattcaatcattgagagttttgctcaaggaggaagaactgtgatc
tcatctagggtttatccaacagaagcaatatacgaagctgcaagattgtttgtgttcaac
aatgcaacagacataaacatcaaggcctcactcaagatttggcaattgaattcagctttt
atacgtccctttccctttcactag

DBGET integrated database retrieval system