KEGG   Phaseolus vulgaris (common bean): PHAVU_011G038300gHelp
Entry
PHAVU_011G038300g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PHAVU_011G038300g
    1.3.1.94  polyprenol reductase
     PHAVU_011G038300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 340 aa AA seqDB search
MLLHDQPMEEVLVQILRAAWLAATLPIVIASLPIPNLSFLRRTLIGFAGRGKIMQSSSQK
FTIPQRLFLHFYAVAFLWTTLLLVATWAYAYSMVPLVAEPFSYSTITSFLTGGSTIRTDS
YKLRQRYVAWEAVFLLFLMEFHVLRRLFETIHVFDYSPSARMHVIGYLTGLFFYIAAPLS
LCGDCAVEVFNFVANLVTEFIVKGKNQMQVTEFEIFQILNPLFRLGWKHWIGTAVFLWGW
IHQYHCHKILGSLRHSTQAEEYVIPQGDWFEIVSSPHYLSEIVIYASFVVATGGSNLTIW
LLFAFVVANLSFAAVETHKWYRQKFEDYPTSRFAIIPFLL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgcatgaccaaccaatggaggaggtcctcgttcaaattctcagagcggcatgg
ctcgctgccacgttaccaatcgtaatcgcgtcccttccgattcccaatctaagcttcctc
cgccgcaccttgattggcttcgccgggcgaggcaaaatcatgcaatcctcctcccaaaaa
ttcaccattcctcagaggctgtttctgcacttctacgcggtggcttttttgtggaccacg
ttgctgcttgtcgcgacatgggcgtatgcgtacagcatggtgccgcttgtagcggaaccg
ttctcgtactctactatcaccagcttcttgacgggtggttccaccatcagaaccgattcg
tataaactgaggcagaggtatgtggcgtgggaagcggtttttctgctttttctgatggaa
tttcacgtcctccgacgactctttgaaaccattcacgtgtttgactacagcccttccgct
cgcatgcacgtcattggttatctcactggattgtttttctacatagcagcaccactatcg
ctgtgtggtgattgtgcagtggaggtgtttaacttcgtagcaaatctagtgaccgagttc
attgtcaagggcaagaatcagatgcaagtgacagagttcgaaatctttcaaattttaaat
cctcttttcaggcttgggtggaagcattggattggtacagctgttttcttatggggttgg
attcatcaataccactgccataaaattctcggttctctacgacattcaacacaggcagag
gaatatgtaattcctcaaggtgattggtttgaaatcgtatcctctccacattatctctct
gagattgttatatacgctagttttgtggtcgctactggaggatctaacctaacaatctgg
ttactttttgcttttgtggtggcaaatctttcatttgcagctgtggaaacacataaatgg
tatcgtcagaaatttgaagattatccaactagtcgatttgctataattccatttcttctg
tga

DBGET integrated database retrieval system