KEGG   Phaseolus vulgaris (common bean): PHAVU_011G187800gHelp
Entry
PHAVU_011G187800g CDS       T03093                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHAVU_011G187800g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PHAVU_011G187800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 296 aa AA seqDB search
MLELPLNMALRFPNLDLQSLPFAQNLNPELLGAIVALLALGFTAAYKYLTRPPKGCLDPE
NFKEFKLIKKTQLSHNAARFRFALPTPSSILGLPVGKNILVRGIDSEGEEVKRSYTPITL
DSDVGYFELVVKMYPNGKMSHHFREMKEGDYLSVRGPKGRFSYKPGQVRAFGMIAGGSGI
TPMFQIIRAILENPKDKTKVHLIYANVTVEDILLKEELDNFADKFPRRFEVYHVLNKAPP
EWNGGIGFISKEIIKSHCPQPAQNIQILRCGPPGMNIAMATHLDELGYTSNMQFQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttggaactaccattgaacatggctcttcgattccccaatttggatttgcagtctctg
ccatttgcccagaatctgaaccctgaactgcttggtgccattgtagctcttcttgctctt
ggcttcactgcagcttacaaatatctcaccagaccacctaaaggatgtttggaccctgaa
aatttcaaagaattcaaactgataaagaagacacaacttagccacaatgctgcaagattc
agatttgctcttcctactccttcttccatattgggtcttcctgttggaaaaaatatactt
gttagaggaatagatagcgaaggagaagaagttaagagatcatatactccaatcacgttg
gattcagatgttggatacttcgaattggttgtgaagatgtacccaaatggaaagatgtcc
caccattttagagaaatgaaggaaggtgattatttgtctgtgaggggtccaaagggacgt
ttcagttacaaacctgggcaagttagggcatttggaatgattgctggaggctcaggcata
actccaatgtttcagatcataagagccattctagaaaaccctaaagacaaaacaaaggtg
cacctaatttatgccaatgtaacagtggaggacattctgttgaaggaagaactagataat
tttgcagacaaatttcctcgcagatttgaagtctatcatgttcttaataaggctcctcca
gaatggaatggtggcattgggtttatatcgaaggagattattaaatcacattgccctcaa
ccagcacaaaatattcagatactaaggtgtggtccaccaggtatgaacatagccatggct
actcaccttgatgaacttggctacacatcaaacatgcagtttcagttctaa

DBGET integrated database retrieval system