KEGG   Plasmodium vivax: PVX_001050Help
Entry
PVX_001050        CDS       T01073                                 

Definition
hypothetical protein
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
pvx  Plasmodium vivax
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PVX_001050
Enzymes [BR:pvx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PVX_001050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1413 aa AA seqDB search
MKTSTSPPNGFADANVNTSGIGNSNSSGNKRGASKNAFTNAASVIWIEREKLDSIIHIPL
YSDLSKYVSDLGRHPVKQKKKEEEEEKEEKEKEKQGGVLSKIFLLFDDNSCNIAVDISAL
YESENDKIPLLIYERYYFWSLHFLFEKSKIKRQKLNICSDTNGRYGINRLNKYDDDVYMY
TSIYNCAYNRNGDEKNVGGSSYSELGRDNCREVNKELTIYNKDYIKYLYLNDLKNNAMRV
SKSNGGDDAAVGGNAGEAFRGSASSGDPLFEKGLYSNNEIKWYRLKIKIESVEKKKKNKN
QNLSKGKGGPAGSHPFSFNGYSSCGNYGSCGNYGSCGNYGSCGNYGSCGSGSKTVDAHHN
SNRAFSCEQRPPNNPNGFKKDTHNPTFNANLMHNVSHLSLIDNDATRKNINNLIKIQKRS
FFMLNQENGKNVLDTSNDEPLLLSSNRRSESVFDSSKRESLASCGHQNGKRRKRRNWFYY
KSSSNETNRGLDDDDRSTSRGNSVCALDRGDSYVESKRKGKGEDKGEGNGVDNGVDNRDH
KGDGPFESSSGCDSAGSPSRSRRRTSKKARSPKGRQPPDGRAKEAAEGVAEEVTEEVAEK
VAEEAAEKVAAKVTAKAAAEIAAEEDSCANSRMPSESRAYVRTVTAGESGTEFHSFDVEE
EVDAMATAPAVAVDPPEKNQQKEERQINTNALFTEETKSPGRLTKNTKVYQENVEEYNSE
FKSIMSEPLNPKEGREKIKRRRDHNRETQMMYLNKILKSIVNKEKSHLNSLSKNFERIEG
FYKQNYKIYIIESKDDLNDKRNCFKSDLHAYVLSPPPSDDISNELNILDQFKMYLRRCRG
DYRPRKYQTHITTGGGKPAGEKPAGEKPVGGGNSGVNLQTNASCTEKKEHSSDNCPGEDH
AGGNAPQKEGEQRGAPMKSSLTKMAPKGKNAEVEDVGETSRSSPQREAGKTHPTNQNPPE
NGIIFYAHNKKNPSSVKELREGDCLYIKFNYSYDDYDKIRVVKKEDLLQILICLMRNQEC
LKLSHISTYSPDLLWNLSVHFKNNTYDMELNLEKMYAHFCRRYEVTSPDGRPGLDLQLGF
APLVERAGDHPFGGQSYLPFDVQSHLPFDGQSYIPFDSQLGGQPGCSPEWSPDRWSDRSS
ECSSEAASEAGARASRSFKSAKRAKRENLKEMEIMKLKDYVSFLDKFLQNVNDAKLKRLK
NIQKEYYKKYEFDRSINKLSRQQLLELFVDRKNEMNTIPLSFLKEKSRNIIYEENIKMNM
FACIKITFDEVKGRCIYAASDLNKFDFVFEYVGELLTHNEAMERERKYNKNKKKGCYMFY
FKHENKRYCIDGTEENIDAAINSKDKKYFLRSFARLVNHSKKNSNLIPKVLTVASLPRLF
FVAARNIKEGEELLIDYGERDREIIKNNEWLKC
NT seq 4242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtcaacgtcaccgccgaacgggtttgcggacgcgaacgtgaacaccagtggg
atcggcaacagcaacagcagcgggaacaagcgcggtgcctccaaaaacgccttcacaaat
gcggcctccgtaatttggatcgaaagggaaaaattagattccattattcacatccccctg
tactcggatctgtccaagtacgtctccgatttgggcagacacccggtgaagcagaagaag
aaggaggaggaggaagagaaggaggagaaggagaaggagaagcagggaggagtgctctcc
aagattttccttctcttcgatgacaacagctgcaacattgccgttgacatatcggctctc
tacgaatccgagaacgacaaaatcccgctgctcatctacgagcggtactacttctggagc
ctgcacttcttatttgaaaaatcaaaaataaaaagacaaaaattaaacatctgctcggac
acgaatggaaggtacggtattaacaggcttaacaaatatgatgatgatgtgtacatgtat
acgtccatatataactgtgcatataatcgaaatggtgatgagaagaacgtcggtggtagt
agctactcggagctgggcagggacaactgcagggaagtgaataaagaattgaccatatat
aataaggactacataaaatatttgtacctgaacgatttgaagaataacgccatgagggtg
agcaagtcaaacgggggggatgatgcagctgttgggggaaatgctggggaagcgtttagg
gggagtgcctctagtggggatccccttttcgaaaaagggctctactcgaacaacgaaata
aagtggtaccgcttgaagataaaaattgagagcgtggagaaaaagaagaaaaacaaaaac
cagaacctcagcaaaggtaaggggggccccgccggcagccaccccttcagtttcaacggc
tacagcagctgcggtaactacggaagctgcggtaactacggaagctgcggtaactacggg
agctgcggtaactacgggagctgcggcagtggaagcaaaacggtcgacgcccaccacaac
agtaacagagccttctcctgtgagcagaggcccccgaacaaccccaacggcttcaaaaaa
gacacgcataaccccacctttaatgcaaacctcatgcacaacgttagccacctgtctctt
atagataacgacgccacgaggaaaaacattaacaatttaattaaaatacaaaagaggtcc
ttttttatgctcaaccaagaaaatggcaaaaatgtattggacacctcaaacgatgaaccg
ttgctgctgtcctcaaacagaaggagcgaatcagttttcgattccagtaagagggagagc
ctagctagctgcggccatcagaatgggaagaggcgcaagaggaggaactggttctactac
aaaagcagcagcaacgaaacgaaccgcggcctggatgacgatgatagaagcacgtccagg
ggcaactcggtctgcgcgctggatcgaggagactcctacgtggagagtaaacggaaaggg
aaaggggaagacaagggggaaggtaacggggtagataacggggtagataacagggaccac
aagggggacggcccctttgaaagttccagcggctgcgactccgcgggctctcccagccga
agccgcagaagaacctcgaagaaggcccgttcgcccaaggggaggcagccccccgacggt
cgcgcgaaggaagctgcagagggagttgcagaggaagtgaccgaggaagttgcagaaaaa
gtggctgaggaagctgcagagaaagttgccgcgaaagtaaccgcgaaagccgccgctgaa
atcgccgcggaagaggacagctgcgccaactcgcgcatgccgtcggagagcagagcatac
gtgcggacggtcaccgcgggggagtccggcaccgaattccatagcttcgacgtcgaggag
gaggtggatgcgatggccaccgctccagcagtagcggtagaccccccagaaaaaaaccaa
cagaaggaggaaaggcaaataaatacaaatgcgctcttcactgaggagacaaagagccca
ggacgtttaaccaaaaacacaaaggtctaccaagaaaatgtcgaagaatacaactccgaa
tttaagagcatcatgtcggagccgcttaatccaaaagaggggagagaaaaaataaaaagg
agaagagaccacaacagggagacacaaatgatgtacttaaataaaattttaaaaagcatc
gtaaacaaagagaagtcccatttgaattctctttcgaagaatttcgaacgaattgaagga
ttctacaaacagaattacaaaatatacatcatcgagagtaaggatgacttaaatgataag
aggaactgttttaagagcgacttgcatgcatacgttttgtctccccctccaagtgatgac
atctccaacgagctgaacattttggaccagtttaaaatgtacctgcgcaggtgcaggggg
gactaccgcccgaggaagtaccaaacgcatatcaccacgggtggtgggaagccagcaggt
gagaagccagcaggtgagaagcctgtaggtggtggaaacagcggagtaaaccttcaaacg
aatgccagctgcacagagaagaaggaacactccagtgataattgccccggtgaagaccac
gcggggggaaacgcaccccagaaggaaggcgagcagaggggtgcccccatgaagagcagt
ttaacgaaaatggctccaaaggggaaaaacgcagaagtagaagacgtaggcgaaacatcc
aggagttccccacaaagggaagccggaaagacacacccgacaaaccagaacccacccgaa
aacggaatcatcttttatgcgcacaataagaaaaacccaagcagcgtaaaagagctaagg
gaaggagactgcctctacataaaatttaactactcatatgatgactatgataaaattagg
gtagtaaaaaaggaagaccttcttcaaatactcatttgcctcatgaggaaccaagagtgt
ctgaagctctcacacatatctacgtactcgccagaccttctgtggaacctgtccgtgcat
ttcaaaaataacacctacgatatggagttaaatttggagaagatgtacgcccacttttgc
agacgctatgaggtgacttcaccggatgggaggcccggcttggatctccagctggggttc
gcccccctggtggagcgagcgggagatcatccgttcggtgggcagtcctatcttccattc
gatgtgcagtcccaccttccattcgatgggcagtcctatattccattcgattcgcagctg
ggtggccaaccgggctgctcccccgaatggtcgcccgatcgctggtccgatcgctcctcc
gagtgctcctccgaggcggcgtccgaagcaggcgcaagggcatcgcgcagcttcaaaagc
gcaaagagagccaagagggaaaacctcaaagagatggaaattatgaagctgaaggattac
gtgtccttcctagataaatttctacaaaacgtaaatgatgccaagttaaagagacttaaa
aacatacaaaaagaatactataaaaaatatgagtttgaccgaagcataaacaagctaagt
aggcaacagctgctggagttatttgtagacaggaagaacgaaatgaataccattcctctt
tcgttcttaaaagagaaaagccgaaacatcatttacgaggagaacatcaaaatgaacatg
ttcgcgtgcatcaaaataacatttgatgaggttaaggggagatgcatttacgcagctagc
gatttgaacaaatttgattttgtctttgagtatgttggagagctactcacacataatgag
gcaatggaacgagaacgcaaatataataaaaataaaaagaaggggtgctatatgttttat
tttaaacacgaaaataaacggtactgtattgacggcacggaggaaaatatcgatgcggct
atcaatagcaaagacaaaaaatacttcttgaggtcctttgctagactggtcaatcactct
aagaagaactccaatctcattcccaaggtgctcaccgtcgccagcctcccgcggctcttc
ttcgtcgccgcgcgcaacatcaaggagggcgaggagctcctcatcgactacggcgagcgc
gaccgcgagatcatcaagaacaacgagtggttgaagtgttag

DBGET integrated database retrieval system