KEGG   Plasmodium vivax: PVX_001075Help
Entry
PVX_001075        CDS       T01073                                 

Definition
(RefSeq) ubiquitin-specific protease
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PVX_001075
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PVX_001075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 383 aa AA seqDB search
MNLTEHKLRDLFYTKNYKYYAKYDNHGSVQRRHTSFQNNGNVCYCNASLQLLLSIKPLCI
YLLNKFDQIYEKTKSKSKYKGDILKALFYIVEETYQVEKEYLCTERHINLLKKMKKYNST
IVINAQNDAHEFLLMLLNYVNVECNRDFNFPQNFEIILDDKDSKEKASEKYWVKYLYKDN
SIVTDLLGFQNVSSITCTQCGHTRHSFEFCLDLGLEFQNEHMQSTSLIDLLKSNIMKSDD
FCHLFCPICKSKQNSCIKKGLYRMPNLYMIIYIKRFKWSYECTNYFKSRVKKIDTTVLLP
WDGLIDFTSFAYMSSHESLSNSKYLIESFICHSGNSYNGHYTAVVKHTDGFYKCNDEKMK
KLSNPFNPENISDIYLLLLRRVT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcactgagcacaagctgcgcgatttgttctacacgaagaattacaaatactac
gccaagtatgataatcacgggagtgtccaaaggaggcacacgtccttccagaacaatgga
aacgtgtgctactgcaacgcctccctccaactgctgctctccatcaaaccgctctgcata
tacctgctgaacaaatttgaccaaatatacgaaaagacgaaatcgaaatcaaagtacaag
ggagacatactgaaggccctcttctacattgttgaagaaacgtaccaagtagaaaaggag
tacttatgcacagaaaggcatattaaccttttaaaaaaaatgaaaaaatataatagcacc
atagtgatcaacgcacaaaatgatgcacacgaatttttgttaatgctactgaactatgta
aacgtggagtgcaaccgcgattttaattttccgcaaaatttcgaaatcattctggacgat
aaagatagcaaagaaaaggcatcagaaaagtactgggtaaaatatctctacaaggataac
agcatagtgacagaccttttagggttccaaaatgtctctagcatcacttgcacccagtgt
ggacacacaagacacagttttgaattttgcctagacttagggttagagtttcagaatgaa
cacatgcaaagtacctccctgattgatttactaaagagtaacatcatgaagagtgacgat
ttttgccacttattttgccccatctgtaaatccaaacaaaatagctgcattaaaaaaggc
ctctacagaatgcccaacttgtatatgattatttatatcaaacgatttaagtggagttac
gagtgcaccaattatttcaaaagtagagtgaaaaaaattgacactactgtgttgctgcca
tgggatgggttaattgattttacatcctttgcctacatgtccagccatgagtctttatct
aactcgaagtacctcatcgagagcttcatttgtcacagcggcaacagctacaatgggcac
tacacagccgtcgttaagcacaccgatgggttctacaagtgcaatgatgaaaaaatgaaa
aaactcagtaacccctttaaccccgaaaatattagcgacatttacctgctcctacttagg
agggtcacctag

DBGET integrated database retrieval system