KEGG   Plasmodium vivax: PVX_079880Help
Entry
PVX_079880        CDS       T01073                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PVX_079880
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PVX_079880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 590 aa AA seqDB search
MTIVNVTVKWKSHVYSDLQLDTSQTILAFKEMLWTLTNVPPEKQKLMYKGLIKDDTDLSS
LNIKHNDKIMLVGSAESLIESPPPVVFVEDLSKEDKERLHAKENILFEDQGIVNLGNTCY
FNAVLQFLTSFDDLGAFLCSIGRKEKHLLKSTNDILFDSYIHFSQTFGKSPEPYVPLELL
KSFRDVFPKFRTVNLRTKQFAQQDAEECMNAILTSLNDQTDCKISDKLFSFKVISKVRCI
EDDASGGGKPTKEKPSSDNAPSENPPSETANEIETTEEFHNKLICYMGTHTTPVNHMHEG
IRLSLIEKIQKQRSEDSKEDALFEKKSEMNSLPPYLIVHFLRFESKKISETNNAISVVTA
KICRKVSFPETFDIYDFCSDELKTQLKVARNIVMKRKEADLNARGGAEAVGGSTAASAQK
NEGVNDTSVNESTNESSNDNTNGVTSDEATAVEGTAAEATAAEATATEEAHGEGSSPTED
LTEIPMGEYELISIITHKGRNEESGHYIAWKKMRSSIGADSNTYKEQLASKKKKGNDSMW
YKMDDDKVSTHKFSSLDLCGGCSDFNIAILLLYKRKTLLCTQEELDSHGK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgttaatgtgacggtaaaatggaagagtcacgtgtacagcgatctacagctc
gacacgtctcagacgatcttggcattcaaggagatgctgtggaccctcacgaacgtcccg
cccgaaaaacaaaaactgatgtataaaggcctcatcaaagatgacacagatctatcctcg
ctaaacataaaacataatgacaaaattatgctagtcggttcagcagagagtttaatagag
agtcccccccctgtagtgtttgtggaggatctctccaaagaagataaagagagattacac
gcaaaagaaaacatcctttttgaagaccagggaattgtgaatttaggaaacacctgctac
ttcaacgcagtgttgcaatttttaacctcctttgacgatttaggggctttcctttgcagc
ataggaagaaaggaaaaacatttattgaaatctacgaatgatattttattcgattcgtat
attcacttttcccaaacctttggaaagtctcctgagccgtatgtccctctggaattgtta
aaatcctttagggatgtattccccaaatttagaactgtcaatttaaggacgaaacagttt
gcccagcaggatgcagaagaatgtatgaatgccattctcacctcattgaatgaccagacg
gattgtaaaattagcgataagttgttttcgttcaaggtgatcagcaaggttaggtgcata
gaggacgacgcgtctgggggagggaaaccaactaaggagaaaccctcatcggataacgca
ccaagtgaaaacccacccagtgaaaccgccaacgaaatcgaaacgacagaagagtttcac
aataaactgatttgctacatgggaacgcacaccacccctgtgaaccacatgcacgaagga
atacgactatccctgattgagaaaattcaaaagcaacgatctgaggatagtaaggaagat
gccctgtttgaaaaaaaatctgaaatgaactccctccctccatatctaattgttcacttt
ttacgtttcgaatcgaagaagatctccgaaacgaataacgccatttctgtcgttacggcc
aagatatgccggaaggtgagttttccagagacgtttgacatttacgatttctgctcagat
gaattgaagactcaattgaaggtagctcgaaatattgtgatgaagaggaaggaagcggac
ttgaacgctcgcgggggtgccgaagctgttggaggaagcactgctgcaagtgcacagaaa
aacgagggcgtgaacgatactagcgttaacgaaagcaccaacgagagctccaacgataac
actaacggtgtgacgagcgatgaggcaacggctgtggagggaacggccgccgaggcaacc
gcagccgaggcaacagctacggaggaagcgcatggtgagggtagcagcccgacggaggac
ttgacggaaatccccatgggggaatatgaactcatttcaataatcacacacaaggggaga
aacgaagaaagtggtcactacattgcctggaaaaaaatgaggagctccataggcgcagat
agcaatacgtacaaggaacagctagccagtaagaaaaaaaaaggaaacgattccatgtgg
tataagatggatgatgataaggtaagcacgcataaattttcttcccttgatttatgtgga
gggtgcagtgactttaacatagctatattgctactgtataagcgaaagaccctgttgtgc
acacaggaggagttggattctcatgggaaatga

DBGET integrated database retrieval system