KEGG   Plasmodium vivax: PVX_080365Help
Entry
PVX_080365        CDS       T01073                                 

Definition
Eukaryotic translation initiation factor 3 subunit 9
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pvx  Plasmodium vivax
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pvx03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 716 aa AA seqDB search
MVKVSESELSDKGLEEFLSDDSDEGNEELLSKKYAEKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIRHLNAKISDSSLLNIKIDMPVDEEKKTKGICFVTFNDSFQANEA
VKILNKLKLDAKHVLTASKMDDIENIINRDEHVMPINVVGFTREKIRWWLYDERCREQFI
VRYDSHFEVHWFDPLEKEPQLIYTTYKKSAPFSSVQWSNQGSYLVSFHNPGIALWGGDNF
EKLIRLQHKSVKEISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEFSA
RDKSYHYFLWSPDDKYIACIGKQKEVYVYELPSMLLMEDHEKKRTPLKYTFVKEFDWSPV
DNIVSIWIPGSKVTPGTLILVDIPSRKELVSRKIYDVVHASIHWQSKGDYLCLKTTIEKK
ISKKSKKEFTQLEIFRIREKNIPVDNIQIEGIKTKQFHWEESNSNRFALIVRDEATSRQQ
IRFYKIENKGTARNAKWTSTFDINSQMNFMRWSPQGSYFILASLGSEGLLYFCCLNASDE
VEVIHKDEHLLANSVSWSNCGRYLVTSVSSMANAASSNYREENSETGFFIWSFQGRCLMT
IKKPSFFQFFFRPHPKSLFSDKQKLEIKNNLKDYSKKFDVMDEKVRHAKRNQLISDRKTV
EASFNQRMEKVTQLFHSFKEYEEFKKNWEQFESQFEWEEKTVVIEHVLSVKQEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtctcggagagcgaactgagcgacaaggggctggaggagttcctgtcggac
gacagcgacgagggaaacgaggaactgctgagcaagaagtacgcggagaaggaggcgctg
atcacgctggaaaccaagttccccaaaatagtgacgatcctggggattccaaaggtggag
gaagaaaagcacagcaggttggcagaggtgctgaaaaagctcttcataagacacctgaat
gccaaaataagtgactcctccctgttgaacatcaaaatagacatgccagtggatgaggag
aagaagaccaaaggaatttgcttcgtcacctttaatgatagtttccaggcaaacgaagcg
gtaaaaattctaaacaagctgaagctggatgccaagcatgtcctaacagcatcaaaaatg
gatgacattgaaaatattataaatagggatgaacacgtcatgccaattaacgtcgtagga
tttacgagagaaaaaattaggtggtggttgtatgacgaaaggtgtagagaacaattcatc
gtcaggtacgactcccattttgaagtccactggtttgatcctcttgaaaaggagccacag
ctcatttacaccacatataaaaagagtgcccctttttccagcgtacagtggagcaaccag
ggatcctacttggtcagtttccacaacccaggtatagctctatgggggggagataatttt
gaaaaactcatccgattgcaacataagagtgtaaaagaaattagcttttctccaaacgaa
aactacgttcttacatgggatggtacccctgcttcgttgagaaatgaaaagtccatatgc
atttggagagtgatcactgggaagttgttacgctcgtttattacgcctgagtttagcgcg
agggataagagctaccactacttcctgtggagcccggatgataagtacatcgcgtgtata
gggaaacagaaagaggtgtacgtttatgagttaccaagcatgttgctgatggaagaccac
gagaagaagaggacccccctgaaatacaccttcgtgaaagaattcgactggtccccggtg
gataatatagtctccatttggatcccagggtctaaggtcactcctgggacgctcatcttg
gtggatatcccctccagaaaggaactcgtttctagaaagatctacgacgttgtgcatgcg
tctattcactggcaaagcaaaggagattacctttgcctgaaaactaccatcgagaaaaag
atcagcaagaagagcaagaaggagttcacccaactggaaatcttccgcataagggaaaag
aacatccccgtggataacatccaaatagagggaatcaaaacgaagcagtttcactgggaa
gagtccaacagcaatcgattcgctctaatcgttagggatgaagctacgagcagacagcaa
attagattttacaaaattgaaaataaaggcacagcgaggaatgccaagtggacgagcaca
tttgatatcaacagccagatgaacttcatgcggtggtcaccacagggatcctatttcatc
ttagcttccttaggatctgaaggactgctctacttttgctgcctcaatgcgagtgacgaa
gtggaggtcatacacaaggatgagcacctcttggcaaactccgtctcctggagcaactgt
ggaaggtacctagtcacctctgtttcgagtatggctaacgcggcgagctccaattatagg
gaagagaacagcgaaacgggatttttcatctggtccttccagggcaggtgcctcatgacc
attaagaagccctccttcttccagttcttcttcagaccacaccccaagtccctattcagc
gacaagcaaaaattggagattaaaaataacctcaaggattactcaaagaagtttgacgtc
atggatgaaaaggtcaggcacgccaaacgaaatcaactcatttccgaccgaaagacggtg
gaggcttcgtttaaccagcgaatggagaaggtcacgcagctcttccactcctttaaggag
tatgaggagttcaagaagaactgggagcagttcgagagccagttcgagtgggaggagaag
accgtcgtcattgagcacgtcctctcggttaagcaggagatattcgcctga

DBGET integrated database retrieval system