KEGG   Plasmodium vivax: PVX_080415Help
Entry
PVX_080415        CDS       T01073                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PVX_080415
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PVX_080415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1346 aa AA seqDB search
MDSPRPPNSPSKNLTLDKIQILNLFKLFDNLPFDPKSENETWHIVNKEFIDSLRSYEEGK
ASRYDALINNKIFVEDASNVTTRTRLLKEYENGNGVSFLLYPEKAIEVLEKHFHFNLKIP
RAVYPYKVPKRERVIYKVDVQPLKLVVYSKNPNEFSSPSKMKIVVLRNDTVEDLLKEIVT
DFDPASFKKNLFYAEEVGGKREYNWERLYLQDSTEFPLKRRIHEYEIDERTCLLITNERA
DIKCLTNESDYGYTRREASFRRSEKEEDCMRGYSSGRAGAYGGGSSTPQAQGHTQGNAHG
NAQGHTQGHTQGYPQQSVAKQISYIFEHGGDRGLVNLGNTCFLNSSLQCLAKIRNFSNYF
LSGTFWNHINYSNPVGQHGRLAKAYYETLLELWKIDKRSEPYAPKVLKQAISEKRDEFYG
YQQHDSQELLAFLLDGLHEDLNLIQKKPYYEEKLQGGLDKQDIDVAEASWNRHKEINNSI
IVDLFQGQYRSRLQCPKCKKVSIAFDPFMYLSIPLPPKKNHRIWFHVILNRDFPIGMRFS
CSFSGSQEVLKLKIFVLTIIKNLKGKRKNILLHNKCIIKNSKDTSPEGRSSHANVITTSS
SSGSSCGGGGNSSTNNAFNFHYKYLDEKNEFYEDNEDNCTSADIANYVRAIKNKSKITST
LKEQDISTVHESICAMCNIQSIDELEINNLSFLFTKFKNLACNQFFQVLNNSDFVTEPHT
RNGKGISHIFVFILPKLCSHLIDKNMEVKVGDESLEVLTNSTVTTNNTSLRDEELNGKGD
PNGGAGTSGGSGISGNSGNGNCSAEKKPLKGKNSHASKILKKRKGVLGSPSSNGSPVRKG
EKTHPSGAEEDEDDELTPGAAPPAGWTGSSRPNVSSNAAEPCDEAMEESNDINMQETCSE
APLNDSNGMSKSRPSCEPHISYNELFRDRILINQDVHSLHDKYFSLLIVPLCKDEQLFYK
MKNNDLPLLFNVPFNFTLNDLYGKVENAYRKTPPGGRTARGAATSSTPTSSGQGSQAEHA
DRYGPPNAHNGNGRRGEEDEIAKKDSISSGDVANKTTTSEYNRVEEEEKGGPSGAHEGET
PHSRITLYLPCYNLKEEWTSKENLGLELKRDETYLSDYIKNSEEKRLIIIHLNSGGIDHE
LSLDIKTITFVDLEERYGIDTCLKLFSEEEHLDENNTWYCGNCKLHVQAYKKLDLFRMPI
ILILHLKRFNNTNRWLRTKIDSYVYYPHKENEYLNMTPYILEDGLKHMMQMDPHYSPLYE
LIGVNCHTGGLCGGHYFAYVKLNGQWYNFNDTFVTTIDESQVNTKNAYLLFYQLHTHKNE
TFTGVADQRNLAEEEAIRMANASYYN
NT seq 4041 nt NT seq  +upstreamnt  +downstreamnt
atggattccccacggccgcccaactcgccgagcaaaaacttgaccctcgacaagatccaa
attttgaatttgtttaagctttttgacaacctgcccttcgacccaaagagcgaaaatgag
acgtggcacatcgtgaacaaggaattcatagacagcctgaggagctacgaagaggggaag
gcgagtcggtacgacgccctcatcaacaacaaaatttttgtggaggacgccagcaacgtc
accacgaggacgaggctcctcaaggagtacgaaaatggcaacggagtgagcttcctcctc
tacccggagaaggccatagaggtgttggaaaagcatttccactttaacctgaagatcccc
agggcggtgtacccctataaggttcccaagagggagagggtaatttacaaggtggacgtc
cagccgctcaaactcgtggtgtactcgaagaaccccaacgagttctccagcccctccaag
atgaagatcgtcgtcctgcgcaacgacacggtggaggacctgctcaaggagatcgtcacc
gacttcgaccccgcgagcttcaagaagaacctgttctacgccgaagaggtgggcggcaag
agggagtacaactgggagcggctctacctgcaggattcgacggagttccccctgaagagg
aggatccacgaatatgagattgacgagcggacctgcttgctaataacaaatgagcgggcg
gatatcaagtgcctgacgaatgagagcgactacgggtacacgaggcgcgaggcgagtttt
aggaggtccgagaaggaggaggattgcatgcggggctactccagcggacgcgccggggcg
tacggtggtggtagtagcactccccaggcgcaggggcacacgcagggaaacgcgcatgga
aacgcgcaggggcacacgcaggggcacacgcaggggtacccccaacagagcgtggccaag
cagataagctacatcttcgagcacgggggggaccggggcctggtcaacctggggaacacc
tgcttcctgaattcctccctgcagtgtctagccaagataagaaatttctccaactatttc
ctcagcggcactttttggaaccacataaactactccaacccagtgggccaacacggacga
ctagccaaagcgtattacgaaacgttgctggagctttggaaaatagataagaggagcgag
ccttatgcccccaaggtgttgaagcaagccataagtgaaaagagggatgaattctacggg
taccaacagcacgattcgcaagaattattggccttccttctggatgggctacatgaggat
ctaaacctaatacagaagaagccctactatgaggagaagctacaaggaggcttggacaaa
caggacattgacgttgcagaagcgtcttggaataggcacaaagaaattaataactccatc
attgtggacctttttcagggccaatatagatcccgcttacagtgccccaagtgtaaaaaa
gttagcatagcttttgacccttttatgtatttgtctatccccttgcctcctaagaagaac
caccgcatttggttccacgtcatcctaaatagggacttccccatcggcatgagattctct
tgctcgtttagcggctcacaggaggtcctaaaattaaaaattttcgttctcacaataatc
aagaatttaaaggggaaaaggaagaacatcctccttcataataaatgtataattaaaaat
agcaaagacacttcccccgagggaaggagcagccacgccaatgtgatcacaacgtccagt
agcagtggcagcagctgtggtggcgggggaaacagcagcactaataatgccttcaatttt
cattataaatatctggatgagaaaaacgaattctacgaagataatgaggacaactgcacc
agtgccgatattgccaattacgtgagagccatcaaaaataaaagtaaaataacgagcacg
ctgaaggaacaagacatctccaccgtccatgagagtatctgtgccatgtgcaacatacaa
tcgattgatgagctagagataaacaacttgagcttcctctttaccaaatttaaaaacctc
gcgtgcaaccaattcttccaagttttgaataactccgattttgttaccgaacctcacacg
agaaatgggaagggcatcagccacatcttcgtcttcatcctccccaagctgtgttcccac
ctcatagacaagaacatggaggtcaaagtgggcgatgagagtttggaggtcctcaccaac
tcgaccgtcaccacgaacaacaccagcctcagggacgaggagctcaacgggaagggcgac
cctaatgggggtgccggcactagcggcggtagcggcattagcggcaacagcggcaatggc
aactgcagcgcggagaagaagccgctcaaggggaagaacagccacgccagcaagatcctc
aagaagaggaagggcgtgctcggctcccccagcagcaacggcagccccgtgcggaagggc
gagaaaacgcacccctccggggccgaggaggacgaagacgacgagctcactcccggggcg
gcgcccccagcggggtggactggaagcagccgccccaatgttagcagcaacgcagcggag
ccctgcgacgaagccatggaagagtcaaacgatatcaacatgcaggagacctgctcagag
gcacccctaaacgattccaacggcatgagcaagagcaggcccagctgcgagccacacatc
tcatacaatgagctgtttagggatcgaattttgatcaaccaggatgtccacagcctgcac
gataagtacttctccctcctgatagtacctctctgcaaagatgagcagcttttctacaaa
atgaaaaataatgatttgcccctcctctttaatgtcccttttaattttacgctgaatgac
ctgtacggcaaggtggaaaatgcctaccggaagacccccccggggggtagaaccgccagg
ggagcagccacttcctccacccccacctctagtgggcaaggcagccaagcggaacacgcc
gatcggtacggaccgccaaacgcacataatgggaatggtagaaggggagaagaagatgaa
attgcgaagaaggatagcataagcagcggcgatgtggcgaataaaaccaccacaagtgag
tacaaccgggtggaggaggaggaaaaggggggcccaagcggagctcacgaaggggaaacc
ccccacagcagaattacactctacctgccctgttacaacctaaaggaggagtggacctcc
aaggagaacctaggcctcgagctcaaaagagacgaaacgtacctctcagattacataaag
aattcagaagaaaagcgcctcataattatacacctcaacagtggtggcatagatcatgag
ctatccctagacataaaaacgattacctttgtagatttggaggaacgctacggaatcgac
acctgtttgaaattattttctgaggaggaacacctcgacgagaacaacacctggtactgt
ggaaattgcaagttgcatgtacaagcctacaaaaaattggacctatttcgaatgccaatc
atcctaatccttcacttaaaaagatttaataatacgaataggtggctacggacgaaaatc
gattcatatgtttactaccctcataaagaaaatgagtatttgaatatgaccccctacatt
ttggaggatggcttgaagcacatgatgcaaatggacccccattactctcctctgtatgag
ctcattggagttaactgccacacgggtgggttgtgtggagggcactacttcgcgtacgtg
aagctcaacgggcagtggtacaatttcaatgacaccttcgtgaccaccattgacgagtcg
caagtgaacaccaagaacgcctacctcctgttttaccagctgcacacgcacaagaacgag
accttcacgggtgtggcggaccagaggaacttggcggaggaggaggccatccgcatggcc
aacgcgagctactacaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system