KEGG   Plasmodium vivax: PVX_080675Help
Entry
PVX_080675        CDS       T01073                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase, faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pvx  Plasmodium vivax
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PVX_080675
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PVX_080675
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PVX_080675
Lipid biosynthesis proteins [BR:pvx01004]
 Desaturase
  First
   PVX_080675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 936 aa AA seqDB search
MWEAFSKSYLNIEHVGVIYITYVVFLASCYIFRKCFSDKFIHFVNISKGLLVTLISLLSL
KYVDLNITLGINLLHVYNISQLCTFLESLCANKKKTNEKPATEENRVVHKYEISKENENE
YRNEYELIGDTSKHLEQLAKKILNNEKSIKENEGILKEKEIIDEIEKKEREEEEYMKKKN
TLDSQKKRDRSKSNSIWIYFFFSQTFYVFFYFFFWRYIHNIMIIKVYLTLQLSKSLTSLA
SHFYHNNTNIKLFKRINHFLSITYMIWLSLFFTKLLYTSNDNSKLLQNFSVLSILFHVYY
AYMVFVNYIYTYHKQFRSSLFSFILFFHIFGVIGMIKLYYHEYGRSLFAQCIIFYLINGF
GITFGAHRLWSHRAFKAGTFVQVLFLILNSFANQGSVITWSKNHRLHHKYSDTKYDPHNI
RYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPLLLWQHKLDPYFNFFFCFIVPGIY
TYFMYNSFWDGFFILGALRWIITLHATWSINSASHSFGHRPYNNDIKASNNIFTSIVALG
EGCHNYHHVFPYCYAMNENFYILSINPTKYVIQFFYHLGLVWDLKCAQNICKEVRLKEAQ
KLEKKNKLLSENIKNEIMKKEDTSYVTDLMNSFTALCNDYINISTFRYITYLLRDFAIMM
TILLIHVYYCYNKYGNGTLFSNMSKNFEAIESNKLISVCSFVFFHIILYALPMGTMFASL
YSLVYECKRGLLFKNPFLNNFFGSIISSFILLPYTSENSRKSLLISLNEDFLKVLKGPIY
FDLYSFIFTIFLGLYGLATYIFGHFYFLIFFIAPYVVFNAWLLTYIYLLNNPPFFTVDMN
AKDVDISVLNYVAFQSLLEWKKNNSIYQSKKRLYKIVFFFLNFIHHHLCYTHIVEFINSK
IPSYRTKEIYKQFDKTLDQYHSLRNDKFIEILKQFL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaggcctttagcaaaagctatctgaatatcgaacatgtaggagtgatttatata
acatatgtcgtttttttggcgtcctgctacatcttcaggaaatgtttctccgataagttt
attcattttgtaaatatttccaagggactgttggttactctcatatctttattaagtttg
aaatacgttgatctgaacatcacgttggggattaacttgcttcatgtgtataacatttcg
caactgtgtacctttttagagtccctttgcgccaataagaaaaaaacaaatgaaaaacca
gcgactgaggagaacagagttgtccacaaatacgaaattagcaaagaaaatgaaaacgag
tacagaaatgaatacgaattgatcggagatacttcgaaacacctggaacagttagcaaag
aaaattttaaataacgaaaaaagtataaaagaaaatgaagggatcttaaaggaaaaagaa
attatagacgaaattgagaaaaaagaaagagaagaagaagaatatatgaaaaaaaaaaat
acccttgattcgcagaaaaaaagagacagatcaaaatcaaatagtatttggatttacttt
tttttctcgcaaacattttatgtattcttctacttttttttctggaggtatattcacaac
atcatgattataaaggtgtatttgactctacagctgagcaaaagtctgacttctttagct
agccatttttatcataacaatacaaacataaagttatttaaacgaattaaccacttcctg
agcattacttatatgatatggctgagtctattttttacaaaattactgtacacctctaat
gataactcaaaattacttcagaatttttcagtcctttctatcttattccacgtatattac
gcctacatggtcttcgtgaattatatttatacgtaccacaagcagttcagatcctcccta
ttttctttcattttgtttttccatatatttggcgtgattggcatgatcaagttgtattac
catgagtatggaaggtccttgtttgctcagtgcataatattttacttaataaacgggttc
ggcataaccttcggagcacaccgtctgtggtcccaccgagcatttaaagcgggtaccttc
gtgcaggttctcttcctaattctgaacagctttgcgaaccaaggaagcgtaataacgtgg
tccaaaaaccaccgcctgcatcataagtacagtgataccaagtacgatccgcataacata
agatatggattcttctatagccatgttggatggttattatatcagaagacaaaatatgtg
aaggagaaggagaaagaaatatatgtggatgatttattacagaacccacttctcctatgg
caacataaattggatccatattttaacttttttttttgtttcattgtaccgggaatatat
acctattttatgtataacagtttctgggacggattcttcattttgggagcgctcagatgg
atcatcacgttacacgccacatggtcgatcaacagtgcctcgcattcatttggacataga
ccctacaataatgatataaaagcttcaaacaacattttcacctccattgtggcgctggga
gaaggatgccacaactaccatcatgttttcccctactgctatgccatgaacgaaaatttc
tacattctgagcataaacccaactaaatacgtcattcagtttttttaccacttgggattg
gtatgggacttgaagtgtgcgcagaatatctgcaaggaggtacgcctgaaggaggcgcag
aaattggagaagaaaaacaaattattaagcgaaaatattaaaaatgaaataatgaagaag
gaagacacgagctacgtaacagacctcatgaactcgttcacagcactttgcaatgactac
ataaacatctccacctttaggtacatcacgtatttattgagagattttgcaataatgatg
accattttgctgattcacgtgtactactgctataacaaatatggaaatggaactttattt
tcaaacatgtctaaaaattttgaagcaatagagagcaacaagctaatttctgtttgctca
tttgtattttttcacatcatattatatgccctccccatgggaaccatgttcgcaagtctg
tattccttggtttacgaatgcaagagaggattactttttaaaaacccatttttaaataac
ttctttggaagtatcatttcgtccttcatacttctaccatacacatcggagaattcgaga
aaatcgttactaatatcgttgaacgaagattttttaaaagtgttaaaaggacccatttat
ttcgatttgtattcattcatatttaccatatttctgggattgtacggactggccacctac
atatttggacacttttactttttaatatttttcatagcaccctatgtagtttttaacgcg
tggttattaacttacatttatttgttgaataatccacccttttttactgtggacatgaat
gccaaggacgtcgatataagtgttttaaattacgtggccttccaatccctacttgagtgg
aaaaaaaacaattccatttatcagagcaaaaaaagattgtacaaaatagttttcttcttc
ttaaattttatacaccatcatttgtgctacacacacattgtggagttcatcaattcgaaa
attcccagttaccgaacgaaggaaatttacaagcagtttgacaaaacgttggaccagtac
cactccctgcgcaatgacaaatttattgaaattttgaagcaattcttatga

DBGET integrated database retrieval system