KEGG   Plasmodium vivax: PVX_081630Help
Entry
PVX_081630        CDS       T01073                                 

Definition
ubiquitin carboxyl-terminal hydrolase family 2
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PVX_081630
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PVX_081630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 3000 aa AA seqDB search
MYNSNDDEEENYSRNRRSNSSDSGNGEGNGMLNDQINTYSHYNNFNRFHEQNMQACKIDE
IYVDDSYDENNSYSQKGEKVGENNHFEASKNVSFDGPYSHKNLREVTENEIELVVDNFFD
RIRNNEDVYSEWKVCPNFIFRLLFIAKSRSNNYMYPVASSFIEAIAKNDWVPDWGFSSVQ
YYIILINLADYRKSYYKIDHFSFSHLNTDRGWHNFVPFEKLREPGFINENGQIVLRAGVF
PFGSESFKNSRDINYDSKSRTGFVGLKNHGATCYMNALLQLLYHINIFRKAVCMMIFNIE
NIIGEKTLEFFKKKFEKKKRRKKCLPGDNSGANQVGVSVGGHGVDSRKTNRKKKKTKLER
VDSSDSERFKGASPMRMVPYTPSDNNGEGEQHGEQHGEQHGEQHREQHREQHREQHREQQ
YGDHPDVDRHDTRRQSGPFGEPELIADPDEPELFQMEKQNSNIRAKKDVKNSDLRMNHLS
RSDDNDNGSSTNGQLRHPNEEPLGAPHNAALGGGSPLMERPYDHPHQLQADNLENVKEKK
TISEYQQMYAPHEEVSNNDGEEAQEGAAYRPNTVVNIGRISSNDIAKMGNIPSVSPHEYE
IKNNKKHAYVHNSSSDPSIDTGGMQNNVSNNDSGEVYYDNSLYKSEGYNNEMVMTVNCKK
NKKKGMVYESKKNLKKKKKIFKYANERKVEQTENNDHVMSPLSSSDNLSNISTLSKEKKK
KKFASNSNFHETVSGNVKKENDNSVNNAVGHSEGEEGPVPRDGGPSPPLGGHHVNSHLNS
HLNSHVDGSAGEDSGADDHPNERGERGTALGGGDEEGSYSDSDMSVLSITSSGSSSYVSC
SSASSSYYHKNKRKTKYDKSKEVDYKNILLEEENEKKNILPTSLALQNLFYKLHCMNEAV
SCKELIRSFGWDASDVFTQQDTHELLKLLLDKVEEQMKGTVVEGSVKKMFEGEVETYIEC
LDIDYKSVRKETYEDIQLDVQGCNNIYESLDKAIEAEVLEGDNIYETDGYGKQKAKKGMR
FLSFPNICIFLLKRFTFDLQRMETVKLNNRFEFYKELDLSKYCQSGGEYILQAVSVHQGN
MNSGHYYSFSYKHNENFWLKCDDDKIFRVSEYSVINDNFGGYDINTERDLYDFDIADKIK
QRMKHYSAYMLVYVKKSLIPKLIKECDPAVVNPQVVKRCRMEEIINRRRTKLKQEILQYV
KIRVFDKYSYLYKSFGDLPPVGIPSLFNIKFDRNKTVLETFCKILKIIKKIYLCKRRKRA
DYLLGQSKKIKVGKAARAERAAEREASQRGTHPMGNPPTSMLLKSEAPADGGDPHRQALL
GEHFHRGRAPKEERDKAGAASSRSDRGSSDGNGGHNRFSHAKLTGKKTHENELNELNEFC
EWSERNECVQEKGPRGDASKKGASKRGVKAECATPEEGPPPQQSSAEDSPSTVSSVPSCC
STKSIDKYIKYLSKRKNERPKRRSSHVNNSRMKNFSSSNNSSYYSSSYSSHSGEDSYSSA
SSSSSNGYVKEKKCFYVLLPTNDVYRYFPLDMKINSQLYLYELLKKTNKESNDLFPTIDI
LYLPYNKKTSIRKNNSNAKNKNVLFFFKYFDIYAEEKIGDTALICLDLMHCDVYLKPKEL
ESRVIQKILKAMKKGYITSYNYDLWRNYLNEEEEYYYVDDPLNFKIFIEYKNKCNLIKSK
KIIAHNKMVPGDILIFNFLSNAELEKKKNFIVRLGTRKEDLFLTEENQVTYDLFFNADVL
SKILYRKKKLIERMNNCCYIVSNRNGVYYKVPSCASYSGDCAFPGVFSSGISNGNGDPTA
GELSRRDLLNDDYFVNGANSHLRRKKTKKETASEVAAQLEANVDFAAPSRVQQENYFAYG
GEQGEEQEGEQGEEAEDVAVGEVAPGAGGTPGLGPIGASLNFYLPVERDLLQGGNPARHA
NGANGADPPLPVPIDDMNDTAHVNDENANFRLLNVPKENLSSQEVMNLYLCLKQLSPKFE
KSGMAYEYSLLSKSMLAPVNEAAVNNKKLIFKKKKKHPPNIYNNECVNICRDYQYPFYSP
PTSDLSTDDEKRVPQKCIQREEVKRKKKKKKHDEAATGASIHKLNYADGQANGLAFKCTP
NGAHALGDKAADGKNTAAASNSDLKNDYGHSNNLRVPSVNFNSSNENNISNDLIARNDSE
ISFCSSANSDLTYTSDSTAYYMFNAEESLESVYTNEIYDHKKKRKKKKKKKKKKKKKMDT
SPERRIDNEEDPLAPPQNRGEYKGNFFNVNSEDEKIEAYVDMPHPGGTAKGGNYPSSGGR
AGQNVKCRVKAGEPGRTHGGDSSGGSNASSGGSSQQSEHPKGHHLGEHFAKQEDPLRKGA
DEASHVGEPHGEPVNRSGRSGRSCRSSPSSRSSRSSRGSGWKQAGGKTSDGRIPINGEHV
SDSVYSYHKNRGDGGARDENTAAGAANGTCEDTDNDAASEAQMNDRSRALLQENMNSINS
MNVQGEAENLLEVSTNVRGEADNVMGEATNVQGEATNVQGEATNILGVPANDSLISSNAP
LGGGRGQENRRRRKNRRAKIIKKCGGVKDKEEPILPFYVICDYLDFVERKIYVKKFRFKL
YDPIYQLGKYRNCAGVVLKKDLKKSCLNYIDSNFIFLKKELCKIDLDIDIRCPTKQIFKH
VCYRMNVDPTHVLIFPYPPLNSPINFNPYNIDSFTSNSDSDGENYPKNGNCTYGPMPFET
LIKQHAIALEHNTLTEQKTFCLSLLPFHYKYFTRLYPEDSPKYFHYVVHLFNANVQSVAA
FTGHIKLRRSFPNKHKGEENYLQEGEANSSSENSGSSASDRSSSTMANRHYMSNNYTTVQ
DLIDKIKLEINPYLKKRGIDVRQKFRLLFTFGPKIKYLSHNEQLVQMDFVKTNHIKNVYV
TPLRMEPDFTDEQKRLIEADQLKIIHVFNQTPSKEVFGYSFDVLVDPNDNMLDIKNRIRK
RTLLPKYIFDKITFFEFENGQRIWRSNDDTINWKNKQFAIIIGEHHAPSQSKPQMGMKIA
NT seq 9003 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacagcaacgacgatgaggaggagaactactcgaggaacagaagaagcaactcg
tcagacagtggcaacggggagggaaacgggatgctaaacgaccagataaacacctacagc
cattataacaacttcaatcgctttcacgagcaaaacatgcaagcgtgcaaaattgacgaa
atatacgtagacgatagttatgacgaaaataatagctacagtcagaaaggagagaaggta
ggggagaacaaccattttgaagcaagcaaaaatgtaagtttcgatggaccgtatagccat
aaaaatctgagggaagttacagaaaatgaaattgagttagtagtagataactttttcgat
cgaattagaaacaatgaggatgtgtattccgaatggaaagtatgccccaattttatcttt
cgccttttatttattgcaaagtcaaggtcaaataattatatgtaccctgtggcttcttcc
ttcattgaggccatcgcgaagaatgactgggtgcccgattggggattcagcagtgtgcaa
tattatataattttaattaacctagcggattatagaaaatcatattacaaaattgatcac
tttagtttttctcatttgaatacggaccgaggttggcacaattttgttcccttcgaaaag
ttaagggaaccaggatttattaacgaaaatgggcagatcgttttaagggccggcgtcttc
cctttcggctcagaatcttttaaaaacagtagagatattaattatgatagtaagtctaga
acaggctttgttggtttgaaaaaccatggggcgacctgctacatgaatgccctgctgcaa
ctcctgtaccatattaacatttttcggaaggctgtttgtatgatgatttttaacatagaa
aatatcattggggagaaaacgttggagttttttaaaaaaaaatttgagaaaaaaaagcgc
aggaaaaagtgcctccctggtgacaatagtggcgccaaccaggtgggtgtcagcgttggc
ggccacggggtggactcgaggaagacgaaccggaaaaagaaaaagacaaagttggaacgg
gtagacagctccgactcggagcgcttcaagggggcctcccccatgaggatggtgccctac
acgcccagcgacaacaacggggagggggagcagcatggggagcagcatggggagcagcat
ggggagcagcatcgggagcagcatcgggagcagcatcgggagcagcatcgggagcagcag
tatggggatcacccggatgtggatcggcatgatacgcgaaggcaaagcgggccctttggc
gaaccggaactcatcgcggaccctgatgaacccgagttgttccaaatggaaaaacagaac
agcaacatccgagcaaagaaggacgtgaaaaattccgacctgcggatgaatcacctaagc
aggagcgacgacaacgataatgggagcagcacgaatggtcagcttagacacccgaatgaa
gaaccgttgggggctcctcacaatgcagccttagggggtgggtcccccctgatggaacgg
ccatatgatcacccccatcagctgcaagcggataatttagaaaacgtgaaggagaaaaaa
acgatcagcgagtaccagcagatgtatgccccccatgaagaggtaagcaacaacgatggg
gaagaagcacaggaaggggcagcgtaccgacccaacaccgttgtgaacattggccgaatc
agcagcaacgacattgcaaaaatgggtaacattccgagcgtcagcccccacgagtacgaa
ataaagaacaataagaagcatgcctatgtgcacaattcgtcgtccgacccgtccatagac
acaggagggatgcaaaataatgtaagcaacaacgatagcggggaggtgtattatgataac
tcgctgtacaaaagtgaagggtacaacaacgaaatggtgatgacagtgaactgtaagaag
aacaaaaagaaaggtatggtctacgaatcgaagaagaatttaaaaaaaaaaaaaaaaatc
ttcaaatatgcaaatgagagaaaggtggagcagaccgaaaataacgaccatgtgatgtct
cccctgagctcgtctgataacctgtccaacatttcgaccctctccaaggagaagaagaaa
aagaagttcgcttcgaacagcaactttcatgaaacggtaagtggtaatgtgaagaaggaa
aatgacaactcggtcaataatgccgtgggccactccgagggggaagagggccccgtgccg
cgcgatgggggcccctccccccccctgggtggtcaccacgtgaatagccacctgaatagc
cacctgaatagccacgtggatgggagcgccggtgaagactccggtgcagatgaccacccc
aatgagaggggtgagaggggcaccgccctgggagggggagacgaagagggctcctactca
gacagcgacatgtcggtcctgtctatcacctcgtccgggtcgtcctcctacgtgtcctgc
tcctcggcctcctcctcgtactaccacaaaaataagaggaaaacaaaatatgacaagtcg
aaagaggtggattataagaacatcctcctggaggaagaaaacgaaaagaagaacatcctc
cccacatccttagcgttgcagaatttgttttacaaactgcattgcatgaatgaagcggtg
tcttgtaaggagctgataagatcctttgggtgggacgcaagcgacgtgttcacgcagcaa
gacacacacgagttactaaagttgctactagacaaagtggaagaacaaatgaaaggaacg
gtagtcgaagggtcagtcaaaaaaatgttcgaaggggaagtagaaacgtatatagaatgc
ctagacatagattacaaaagtgtgagaaaagagacctacgaagatatccagctggacgta
caaggctgcaacaatatttatgaatcgctcgacaaagcaatcgaagcggaagtgttagag
ggagacaacatttacgaaacggatgggtatggaaagcagaaggcaaaaaaaggaatgcgc
tttttaagcttccccaacatttgcatatttctcctgaaaagatttacattcgatctgcaa
cgaatggaaacggtgaagctaaataaccgattcgaattttacaaagaattggatctctcc
aaatattgccaaagtggaggtgaatacatcctacaggcagtgtcagtgcaccaaggaaac
atgaacagtggccactactactcctttagctacaaacataatgaaaacttctggctcaaa
tgtgatgatgacaaaatattccgcgtgagtgaatactcagtcatcaatgataacttcggt
ggatatgacatcaacacggaaagggacctctacgactttgatattgcagacaaaataaaa
cagaggatgaagcattacagtgcttatatgctggtgtatgttaagaagtccctcatccct
aaacttattaaagagtgcgacccggcggtggtcaacccacaggttgttaagagatgcagg
atggaagaaatcatcaacaggaggaggaccaaactgaaacaggaaatattgcaatacgtc
aaaattagggtcttcgacaagtactcctatctgtataagtcgtttggcgacctcccccca
gttggcatcccctccctcttcaatatcaaatttgatagaaacaaaaccgttttggagacc
ttttgtaaaatcttgaaaatcataaagaagatctacctctgcaagaggaggaagcgcgcg
gattatctgctcggccagtcgaagaagatcaaggtgggaaaggcggccagggcggagagg
gcggcggagagggaggcgagtcagcggggcacgcaccccatggggaacccccccacttct
atgttgctcaaatcggaggcgccggcggacgggggagacccccaccggcaagctctctta
ggtgagcacttccaccgcgggagggctcccaaggaggagcgtgacaaagcgggagcggct
tccagccggagcgaccgcggaagcagcgatggaaatggaggacacaaccgcttttcacac
gcaaaattaacggggaagaaaacgcacgaaaatgagttgaatgagctgaacgagttctgc
gagtggagcgagcggaatgagtgcgtccaggagaagggcccccgaggggacgcctcaaaa
aagggggcgagcaagcggggtgtaaaggcagagtgtgctaccccagaagagggccccccc
ccacagcagagctccgcggaggactccccatccaccgtgtcctcagtcccttcatgctgc
agcaccaagtcgatagataagtacattaaatatttatccaagaggaagaatgaaaggccg
aagaggagatcatcccacgtgaacaactccaggatgaaaaatttttcctcgtcaaacaat
tcgtcgtactactcctcttcgtattcatcccactcaggggaggactcctactcctccgcc
tcctcctcctcatcgaatggctatgtaaaggagaagaagtgtttctacgtgttgctcccc
accaatgatgtgtaccggtatttccccctggacatgaagatcaacagccagctgtacctc
tacgaactgctaaaaaaaacgaacaaagaatcgaatgacctcttcccaaccatagacata
ttgtatctgccctataacaaaaaaacgtccattcgaaaaaacaattcgaacgcaaaaaat
aaaaacgtcttgttcttttttaaatactttgacatttacgcggaggaaaagataggagat
acggccctcatctgtctcgacctcatgcactgcgatgtgtacctcaagcccaaggagtta
gagtctagggttatccagaagatattgaaggcaatgaaaaagggctacattaccagctat
aattatgacctgtggaggaactacctcaatgaggaggaagaatactactacgtagacgac
cccctcaattttaaaattttcatcgaatataaaaataaatgtaacttaataaaatccaaa
aaaattattgctcacaataagatggttccgggggacatcctcatctttaacttcttaagt
aatgcagaattagaaaaaaagaaaaattttattgtccgcttgggcacaaggaaggaggac
cttttcctcaccgaggagaaccaagtcacctacgatctcttttttaatgctgacgtgttg
agtaaaattctgtataggaagaaaaagctcatcgaaagaatgaataactgttgctacatt
gttagcaataggaatggcgtttactacaaggtgccctcctgcgcctcctattctggtgac
tgtgccttccccggcgtgtttagcagcggaatctccaacgggaatggggaccccaccgcg
ggtgaactcagccggagggaccttctcaatgatgactacttcgtgaatggggcgaattct
catctgaggaggaagaagacgaaaaaggagacggcgtcggaagtggcggcccagctggag
gcgaacgtcgattttgccgccccgagtcgtgtgcagcaggagaattacttcgcctacggg
ggggagcaaggagaggagcaagaaggggagcaaggagaggaggcagaagacgtcgccgtg
ggagaggtcgccccgggagcgggaggcacccctggcttgggcccaattggcgcaagtttg
aacttctacctcccagtggagagggacctgctgcaggggggcaacccggcgcgtcacgcg
aatggggcgaacggtgcggacccccccctgccggtgcccatagacgatatgaacgacacc
gctcacgtaaatgacgaaaacgcaaacttccgtttgctaaacgtgccgaaggaaaatctg
agcagccaagaagtgatgaacctctacctctgcctcaaacagctgagtcccaaatttgag
aaaagcggaatggcctacgaatacagcttgctaagcaaaagcatgttggcgcccgtgaac
gaagctgccgttaacaacaaaaaactcatttttaaaaagaagaagaagcaccccccgaac
atttataacaatgagtgtgttaatatttgcagagattaccagtacccgttttactctcct
cccacttcggatctctcaacggatgatgagaaaagagtgcctcagaagtgtattcaaagg
gaggaagtcaaaaggaagaagaaaaaaaaaaaacacgacgaggctgcaacgggtgcttcc
atacacaagttgaattatgctgatggtcaagcgaacggattagcgtttaagtgcaccccg
aatggtgcccacgcattgggagacaaagcggcggacgggaagaacaccgccgcggcgagc
aacagtgaccttaaaaacgattacggacatagtaacaacctgcgagtgcccagcgtcaac
tttaattcttccaacgaaaataacatttcgaacgatttaatcgccaggaacgactccgaa
atatcgttttgctcctcggccaactcggacctgacctacacctcggacagcacagcctac
tacatgttcaacgcggaggagtccctagaatctgtgtacacgaacgaaatatatgaccat
aagaagaagcgaaaaaaaaagaagaaaaagaaaaaaaaaaaaaaaaaaaaaatggatact
tcaccggagagaagaatcgataatgaagaggatcccttggctcctccgcagaacaggggt
gaatataaggggaacttttttaacgtaaattcggaagatgagaaaatcgaagcgtatgtt
gatatgccccatccggggggaacagcgaaagggggtaattaccccagttcgggtggccgg
gcaggccagaacgtcaaatgcagggttaaagcgggagaaccgggtcgcacccacgggggg
gatagcagcggtggaagcaacgcaagcagtggcggtagcagtcagcagagtgaacatccc
aaggggcaccacctcggtgagcacttcgcaaaacaggaggaccccctcaggaaaggcgcc
gacgaggcgtcacacgtgggagagccacacggggagccagtcaacagaagtggaagaagt
ggtagaagctgtagaagtagtccaagcagccgaagcagccggagcagcaggggcagcggc
tggaagcaggcgggagggaaaacttcggacggcaggatccccataaacggcgaacacgtg
agcgatagcgtctattcctaccataagaacagaggagacgggggggcacgcgatgagaac
accgcagctggggcagcaaatgggacgtgcgaggacacggacaatgacgcggccagcgag
gcgcagatgaacgacaggagcagggccctgctgcaggagaatatgaacagcataaacagt
atgaacgtgcagggggaagcggaaaacctactggaagtgtcaacgaacgtgcggggcgaa
gcggacaacgtgatgggggaagcgacaaacgtgcagggcgaagcgacaaacgtgcagggc
gaagcgacgaacatactgggagtgccagccaatgacagcctcatcagcagcaacgccccc
ctgggcggcggcagaggccaggagaaccgcagaaggagaaaaaacaggagagccaaaatt
ataaaaaagtgcggcggagtgaaggacaaggaagaaccaatcctgcccttctacgtcata
tgcgactatctagattttgtagaaaggaaaatatatgtgaaaaagtttcggtttaaactg
tacgacccgatttatcaactggggaagtaccgcaattgcgcgggggttgttctgaagaag
gatttgaaaaagagttgcctgaattacatcgactcaaattttatatttttaaaaaaggag
ttatgcaaaatagatttagacattgacattaggtgtccaaccaaacagatctttaagcac
gtttgctaccgaatgaatgtagatccaacacatgtgttgattttcccctaccctccgttg
aatagccccatcaattttaatccatacaatattgattcgttcacatctaactcagattcg
gatggagagaattacccgaaaaatggcaactgcacgtatgggcccatgcctttcgaaacg
ctaataaaacaacatgccatagcgttagagcacaatacgctgaccgaacagaaaaccttt
tgtttgtctctccttccttttcattacaagtattttacgagactctacccggaggattcc
cccaagtatttccactacgtagttcacctgttcaacgcgaatgtgcagtcagttgcggca
tttacagggcatattaagctcaggagaagtttccctaataaacataaaggggaggaaaat
tacctccaagagggggaggctaactcgagcagtgaaaactcaggttcttccgcctcggac
agatccagtagcaccatggcgaaccgacactacatgtccaataattacacaactgtgcag
gatttaattgacaaaattaagttagaaattaacccctatttgaaaaagagaggcatagac
gtcaggcaaaagttcagattgctctttaccttcggccccaaaattaagtacctcagccat
aatgagcagctcgttcaaatggatttcgtcaaaacgaatcacatcaaaaatgtgtacgtc
accccgctgaggatggagcccgattttaccgacgagcagaagcgtttgatagaggcggac
cagctgaagataatccacgttttcaaccagaccccttcgaaggaagttttcggctacagt
tttgacgtcctcgtggatccgaatgacaatatgctggacatcaaaaacaggataaggaaa
aggaccctcctgccaaagtacattttcgacaaaatcaccttcttcgagtttgagaacggc
cagaggatttggaggtccaacgacgacacgatcaactggaagaacaagcagttcgcgatc
atcataggagaacaccatgccccatcccagtcgaagccccaaatgggaatgaaaatagca
taa

DBGET integrated database retrieval system