KEGG   Plasmodium vivax: PVX_083135Help
Entry
PVX_083135        CDS       T01073                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pvx  Plasmodium vivax
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PVX_083135
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PVX_083135
Enzymes [BR:pvx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PVX_083135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 372 aa AA seqDB search
MIEIVGSLALAFTLLLAVVLAHITAGTRKKKLIIDRKGELSSKYKIDFDIISQGMKRKNV
INVDDITDEELLVILFTAKKFESLLKNKKDTKFLENKVFCSIFLEPSTRTRCSFDSAILR
LGSKVINITDMNSTSFYKGETVQDAFTILAKYVDGIIYRDPSNNNVDLAVAASDKPIINA
GNGTGEHPTQSLLDFYTIYNFFPYILERDINQKINVAFVGDLKNGRTVHSLSKLLSRYNV
NFIFISCKSLDIPENIVHIITNNLKWNNFYNENSIRKYDNLEKGLKDVHVIYMTRIQKER
FTDLNEYNAYKDAFILDNRVLENTRMDTKVLHPLPRVNEIKVEVDDNPKSVYFLQAENGL
YVRMALLYLIFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatagttggctcgctggccttagccttcacgcttttactggccgtggtcctg
gctcacataaccgcagggacgagaaaaaagaaattaatcatcgacagaaaaggagagctg
agcagcaagtacaaaatcgattttgatataatttcgcaaggaatgaaacgtaagaatgta
ataaatgtggatgacataactgacgaggaattgctagtcattctgttcaccgcgaagaag
tttgagtctttgctaaaaaataagaaggacacaaagttcctggaaaataaagttttctgt
agcatcttcctggagcccagtacaagaacgagatgttccttcgactctgcaattttgaga
ctgggttcgaaggtgataaatattacggacatgaattccacgtcgttttacaagggggaa
actgtgcaggacgcgttcaccattttggcgaaatatgtggacgggattatataccgggat
ccctcgaataataatgtcgacctcgccgtcgccgcgtccgacaagccaatcatcaacgcg
ggaaatggcacaggggaacacccaacacagtcactcctagacttctacaccatatacaat
ttcttcccgtacattttggaaagagacataaaccaaaaaataaacgtggcctttgttgga
gatttaaaaaatggaaggactgttcattcgcttagcaaattgctgagcagatataatgtc
aattttatttttatatcttgcaagtcgctggatattcccgaaaatattgtgcacattata
acgaacaatttgaaatggaacaatttctacaatgaaaattctattagaaaatatgacaat
ttggagaaaggattaaaagatgtgcatgtgatatacatgacacggatacagaaggagagg
tttaccgacttaaacgagtacaacgcgtataaggacgccttcattttggataaccgcgtt
ttggagaataccaggatggatacgaaggtcctgcaccccctccccagggttaacgaaata
aaagtcgaagttgatgacaatcccaaaagtgtgtactttttgcaggccgaaaacggattg
tatgtgaggatggccctgttgtacctcattttttcgtaa

DBGET integrated database retrieval system