KEGG   Plasmodium vivax: PVX_083470Help
Entry
PVX_083470        CDS       T01073                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pvx  Plasmodium vivax
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pvx00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 501 aa AA seqDB search
MKVILSIDQSTQSTKLIFFDEELNVLHTNSLNHEQKCFKPGWYEHDPVEIINNLYTLMND
GMKALKEKNKEVEIKCIGITNQRETVIIWDKLTGKPLYNAIVWLDTRVEDIVAQFSKKYN
NDYFQKKTGTYFNTYFSGFKILWLIQNNQEIRKKVEEGSAIIGNVNTWLIYNLTNGNSYT
DVTNASRTLLMNINTLEWDEELCKMFGITNMSVLPEIKCNCFNFGEVMSEQVPDYAGVPI
TGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLINTGYKVVYSSCGLITTVCYKFNENDQ
AKYALEGSIGTAGSGVSWLLKNNLISHPSEASYIMENCEDTGGVVFVPAFSGLYAPRWRS
DARACITGMTFNTERKHIVRSLLEGIVFQLNEIVCSLISDMGIEMLHVLRCDGGMTKNKA
FMQFNSDLINTKIEVSKYSEVTALGAAVLAGLGVKIWEDLDSVKSLIRSSDSTFNSKMDA
KSRKRRISEWGKAVERSLLQM
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcctgagcatagaccaaagcacccagtcgacgaagctgatttttttcgat
gaagagctgaacgtgctgcacacgaacagcctgaaccacgagcagaagtgtttcaagccg
gggtggtacgaacatgacccagtggagataattaacaacctgtataccctgatgaatgat
ggcatgaaggctcttaaggaaaagaacaaagaggtggaaatcaaatgtataggaattaca
aaccagagagagacggtcatcatatgggataagctaactggcaagcctttgtataatgcc
attgtgtggctggacacccgagtggaagacatcgtcgctcagttttcaaagaaatataac
aacgattattttcagaaaaaaacaggaacgtattttaacacctattttagtgggtttaaa
attttgtggctaattcagaacaatcaagaaattaggaagaaggtggaggaagggtccgcc
atcatcggtaatgttaacacttggctgatttataacctaacaaatgggaacagctacaca
gatgtgacgaatgcctctaggacccttttgatgaatattaacacgttagagtgggatgag
gagctgtgcaaaatgtttggcattacaaatatgtctgttcttccagaaattaaatgcaac
tgtttcaattttggagaggtgatgtctgagcaagtgcctgactatgcgggggtgccaatc
actgggtgcattggggaccagcaaagtgcatgcattggacaagctatttttgatgaagga
gaagccaagtgtacctatggcactggcgtttttttacttatcaatacagggtacaaagtg
gtgtactcttcttgtggtttaattacaaccgtgtgttacaaatttaatgaaaatgatcag
gcgaaatatgcgttggagggttctataggtacagctggttcaggtgtttcatggctgttg
aagaacaatttaatttctcatcctagtgaagctagctatattatggagaactgcgaagat
acaggaggggttgtgtttgttccagccttcagtggtttgtatgcccccaggtggaggtca
gatgccagggcatgtataactggcatgacattcaatacggaaaggaaacacatcgttcgg
tccctcctggagggcatcgttttccagctgaacgaaattgtttgctccctcatctcagat
atgggcatagaaatgctccatgttttacggtgcgatggggggatgaccaaaaataaggct
ttcatgcagttcaactcggatcttataaacacaaaaatcgaagtctcaaaatattctgaa
gttactgccctgggggctgccgtgctcgctggcttgggggtcaaaatttgggaagatttg
gactccgttaaaagcttaatacggagtagcgactccacgtttaactctaaaatggatgca
aaaagtagaaagaggagaatttccgagtggggcaaggccgtcgagcgctcgctcctgcag
atgtag

DBGET integrated database retrieval system