KEGG   Plasmodium vivax: PVX_084630Help
Entry
PVX_084630        CDS       T01073                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pvx  Plasmodium vivax
Pathway
pvx00480  Glutathione metabolism
pvx00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PVX_084630
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PVX_084630
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PVX_084630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Emaravirus_P4
Motif
Other DBs
NCBI-GeneID: 5475901
NCBI-ProteinID: XP_001616593
UniProt: A5K0L9
Position
13
AA seq 201 aa AA seqDB search
MMKLFLFSLLFVVLLILRRNPANMFSFFKKITVSKGELRPSIYDYHVKKLDGTTVPMSTY
KNKVLLIVNSASKCGLTRKHVDQLNELHDRLNERGLEILAFPTSQFLSQEFPNTCDISSF
NEKNKIKYNFFSPIEVNGENTHELFKFLKANCDSMHDKNGQLENIGWNFGKFLVNRSGNV
VSYFSPRTNPLDIEKNITELL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttttcctgttttcactgctattcgtcgtgttgttaattttaagaagaaat
cctgccaacatgtttagcttcttcaaaaaaataaccgtttcgaaaggggagttgcgcccc
tccatttatgattaccatgtgaagaagctggatggaacaactgtgccgatgtctacttac
aagaacaaggttttgctgattgttaactctgcgtccaagtgcggcttaacgcggaagcat
gtggatcagcttaacgagttgcacgatcgattgaacgagcggggattagagattttggcc
ttcccgaccagccagttcctaagccaggaatttcccaacacgtgtgacatttcctcattt
aacgagaaaaacaaaatcaaatataacttcttctccccgattgaagtcaatggagaaaac
actcatgagctgttcaaatttttgaaagccaactgtgactcgatgcacgacaagaacgga
cagctagaaaacatcggatggaactttggaaaatttttagttaacaggagcggaaacgta
gtcagttatttttccccaagaactaacccccttgacattgagaagaacataaccgaattg
ttgtaa

DBGET integrated database retrieval system