KEGG   Plasmodium vivax: PVX_084630Help
Entry
PVX_084630        CDS       T01073                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pvx  Plasmodium vivax
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PVX_084630
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PVX_084630
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PVX_084630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 201 aa AA seqDB search
MMKLFLFSLLFVVLLILRRNPANMFSFFKKITVSKGELRPSIYDYHVKKLDGTTVPMSTY
KNKVLLIVNSASKCGLTRKHVDQLNELHDRLNERGLEILAFPTSQFLSQEFPNTCDISSF
NEKNKIKYNFFSPIEVNGENTHELFKFLKANCDSMHDKNGQLENIGWNFGKFLVNRSGNV
VSYFSPRTNPLDIEKNITELL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttttcctgttttcactgctattcgtcgtgttgttaattttaagaagaaat
cctgccaacatgtttagcttcttcaaaaaaataaccgtttcgaaaggggagttgcgcccc
tccatttatgattaccatgtgaagaagctggatggaacaactgtgccgatgtctacttac
aagaacaaggttttgctgattgttaactctgcgtccaagtgcggcttaacgcggaagcat
gtggatcagcttaacgagttgcacgatcgattgaacgagcggggattagagattttggcc
ttcccgaccagccagttcctaagccaggaatttcccaacacgtgtgacatttcctcattt
aacgagaaaaacaaaatcaaatataacttcttctccccgattgaagtcaatggagaaaac
actcatgagctgttcaaatttttgaaagccaactgtgactcgatgcacgacaagaacgga
cagctagaaaacatcggatggaactttggaaaatttttagttaacaggagcggaaacgta
gtcagttatttttccccaagaactaacccccttgacattgagaagaacataaccgaattg
ttgtaa

DBGET integrated database retrieval system