KEGG   Plasmodium vivax: PVX_084705Help
Entry
PVX_084705        CDS       T01073                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PVX_084705
Protein kinases [BR:pvx01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PVX_084705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 846 aa AA seqDB search
MRCNERNKKKAIFSNDDFSGEDTLMEDHLQLREKLSEDIEMIKASLKNNLVCSTLNDNEI
LTLSNYMQFFVFKGGDLVIKQGEKGSYFFIINSGKFDVYVNDKKVKSMGKGSSFGEAALI
HNTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNM
ITNACVIQMFKPGETIVKQGDYGDVLFILKEGKATVFINDKEIRVLNKGSYFGERALLYD
EPRSATIIAKEPTACASICRKLLNIVLGNLQVVLFRNIMTEALQQSEIFRQFSAEQLNDL
ADTAIVRDYPANYHILHKDKVKSVKYLIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQ
KQKFRHTVKSLDVCKIALITESCLADCLGDNNIDASIDHNNKKSIIKKMYIFRYLSEQQC
NLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEVTKNGKRLRTLGKNDYFGERALL
YDEPRTASIISKATSVECWFVDKSVFLQIIQGPMLTHLEERIKMQDTKVEMHELETERII
GRGTFGTVKLVHHKPTQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRT
FKDSNCFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKP
ENILLDKQGYVKLIDFGCAKKIQGRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLY
EFICGPLPFGNDQEDQLEIFRDILTGQLTFPDYVSDQDSINLMKRLLCRLPQGRIGCSIN
GFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETYAEDIDIKQIEEEDALNEGEPLDGDD
SWDVDF
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcaatgagcggaataagaagaaggccattttttcaaatgacgacttctcgggg
gaagacactttgatggaggaccacctccaactgagggaaaagctttcagaagacatcgag
atgataaaggcgtcgctgaaaaataacctcgtttgcagcacgttgaacgacaatgagata
ttgaccctgtctaactacatgcagtttttcgttttcaagggtggcgacctggtgatcaag
cagggggagaaaggatcctacttcttcatcataaacagcggcaagttcgacgtgtacgtg
aatgataagaaggtgaagagcatggggaaggggagctccttcggggaagcggcgctaatc
cacaacacgcagaggagcgcgacgatcatggctgagacggacgggactctctggggggtg
cagaggagtaccttcagagcaacactaaagcaactgtctaatcggaatttcaacgaaaac
aggagcttcatagattccgtgtccgtatttgacatgctgacggaagcacagaagaatatg
atcaccaacgcgtgcgttattcagatgttcaaaccgggggagacgattgtgaagcagggc
gattatggcgatgtgttgtttatactgaaggaaggtaaagccacagtttttattaacgat
aaagaaataagagtacttaacaaagggtcctacttcggagaacgagcgctgctgtatgac
gaacccagaagcgccaccatcatagcgaaggaacccacggcatgcgcgtcgatatgcaga
aagctgctaaacatagtgctggggaatctgcaggttgtcctcttccgcaacatcatgacg
gaggcgttgcaacagagcgaaatatttaggcagttcagcgcagagcagttaaacgatcta
gcggatacagccattgttagggattacccagcgaattaccacatcctgcacaaggataag
gttaagtctgtgaagtacctcatcgtgttggagggtaaggtggagttatttctggatgat
gaatcgatagggatcctcaccagggggaagtccttcggggatcagtacgtgttaaatcag
aagcagaagttcaggcatacagtcaaatcgctggatgtgtgcaaaattgctctcatcaca
gaatcctgtttggcggactgcctaggagacaacaacattgatgcgtcgattgatcataat
aataagaagagcatcatcaagaagatgtacatttttaggtacctaagtgagcagcaatgc
aatttacttatcgaagcgtttaggaccacgagatatgaagagggggactacatcattcag
gaaggagaggtgggttctagattctacatcataaagaatggggaagtagaggtgaccaaa
aatgggaagagattacgaacgctggggaaaaatgactactttggggagagggccctcctt
tatgatgagcccagaacagcctccatcatcagtaaggccaccagtgttgagtgctggttt
gtagacaagagtgtctttttgcaaatcatccagggacccatgttaactcacttggaggag
cgaatcaaaatgcaggacaccaaagtggagatgcacgaattggagaccgaaaggattata
ggcagaggtaccttcggaaccgttaagttagtgcaccacaaaccgacacaaattagatat
gcactaaagtgcgttagtaagagaagcatcatcagtctaaatcagcagaataatataaaa
ctggagagagaaataactgcagaaaatgaccacccatttattataagacttgtgaggaca
tttaaagattccaattgtttttactttctaacggagctggtcactgggggggaactctat
gatgccattcgaaaattaggtctgctctccaaacctcaggcacagttctacttagggtcc
ataatactagccatagaatatctgcacgagaggaatattgtctatcgagatttaaagcca
gagaatattctcctagacaaacagggctacgtaaaactgatcgattttggttgcgcgaag
aagattcagggcagggcctacactcttgttggcactcctcactacatggcgccggaggtt
atcttggggaaaggctacgggtgcactgtggacatatgggctttgggagtttgcctctac
gagtttatttgtggccccctcccatttggaaatgaccaagaggatcaactggaaatattc
agagacattctaacggggcagttaaccttccccgactatgtatccgaccaggatagcata
aatttgatgaagcgactgttgtgcagactgcctcagggacgaattggatgctccataaac
gggtttaaagatattaaggagcacgccttctttggcaacttcaactgggataagctggcg
gggcgcttgctggagcccccgctggtgtccaagggggagacctacgcggaggacatcgac
attaagcagatcgaggaggaggacgcgctgaacgagggcgagccgctcgacggggatgac
agctgggatgtggacttttga

DBGET integrated database retrieval system