KEGG   Plasmodium vivax: PVX_084910Help
Entry
PVX_084910        CDS       T01073                                 

Definition
protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PVX_084910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 224 aa AA seqDB search
MYTLAEDSHKSLIDSLKDRGIIDDDDVYETMLQVDRGKYIQEKPYVDTPVYISHGVTISS
PHMHALSLKRLMDVLKPGSRAIDVGSGSGYITVCMAIRTKVLENKDSFVIGLERVKDVAN
FSIENIKRDKPELLHLDNFKIIHKNIYQVSEQEKEELGLFDAIHVGASASELPQILVDLL
AENGKLIIPLDEGYTQVLYEITKHNGQIIKDRLFDVCFVTLKKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtacacccttgcggaagacagccacaagagtttgatcgacagtcttaaggacagaggc
ataattgacgatgacgacgtgtacgagacgatgctacaggtggacagggggaagtacatt
caggagaagccctacgtggacacgcccgtctacatcagccacggggtgaccatatcctcc
ccgcacatgcacgccctgtctctgaagcgcctgatggatgtgctgaagccggggtcccgg
gccatcgacgtggggtccgggtcgggctacattaccgtgtgcatggccataaggacgaag
gtgctggagaacaaggactccttcgtgatagggctggagagagtgaaagacgtggccaac
ttttccatcgaaaatataaaaagagacaagccagagttacttcatttggacaattttaaa
attattcacaaaaatatttaccaagtgagtgaacaagagaaggaggagttgggactgttc
gatgccattcatgtgggagcatctgcaagtgagttgccccaaattttagtagaccttttg
gcggagaatgggaagctcatcatccccctggatgaggggtacacgcaggttctgtatgaa
attaccaagcacaacgggcaaataataaaggataggctcttcgacgtttgcttcgtcact
ctgaagaagaattag

DBGET integrated database retrieval system