KEGG   Plasmodium vivax: PVX_084965Help
Entry
PVX_084965        CDS       T01073                                 

Definition
mitogen-activated protein kinase 1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pvx  Plasmodium vivax
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 739 aa AA seqDB search
MKEGQASKEEQVDESVLRKYDVLRKIGKGAYGVVYKARCKKNRKIVAVKKIFGAFQNSTD
AQRTFREIMFLHQLNGHDNIITLMDVIRAKNDNDIYLVFDYMETDLHEVIKADLLEEIHK
RYIIYQLLRALKYIHSGMLLHRDIKPSNILLNSECHIKVGDFGLARSISTDLSENKIPVL
TDYVATRWYRAPEILLGSTNYTEGVDMWSLGCIMGELLLGRPLFRGNSTMNQLEKIIQVI
GKPTKKDMDDIKSPFTDTIISSFVNIKRKNFSEIFAKASVEAVDLLKRLLQFNPTKRISA
EDALRHKYVEQFHSIIDEPVCKRIITIPVDDGTKYRVSFYRNIVYYDIMRRKGCRPGGGQ
KGVERAVERAVQQAGQQTGQQAGQQTGQQAGQQTGQQAGQQTGQQAGQQTGQQAGQQTGQ
QAGQQTGQQAGQQTVHQSVDDAPSGEVADTPLSRCASKGKAQSTAARITPHEGKCAPKIR
STQSIHQGGSGGSGGRGESGRRGERGRRGESGRRGIHDAETSRDNKSAKCQPKRSSKREG
PQERHNGKECGHPNEKHYYEVASEGKEVRSAQVESRGSRTKAFNGDAAGKLHKGASERGK
AVASAASVGVTRRNDDKGGTTGGRKVHGKTASVVRGEHMVRSVDGRADSRAVRRADSRAD
IRADKLVRSHLVSAADVEAAKPGPPRVQPAAPQKEEAAKWRKRGGGKAGAAGVAARRVDF
CGAHCHGITATAEKKSLKK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagggccaggcgagcaaagaggagcaggtggacgaaagcgtgctgaggaaatac
gacgttttgaggaaaataggaaaaggggcgtacggggtggtgtacaaagccaggtgcaag
aaaaacagaaaaattgtggcagtgaaaaagatttttggagcatttcaaaactctacggat
gcgcagaggaccttcagagagattatgttcctccaccagctgaacgggcacgacaatatc
atcaccctgatggatgtaataagagcgaaaaatgataatgacatttacctggtgtttgat
tacatggaaacagatttacatgaagtgataaaggcagatttgctggaagaaatccacaag
aggtatatcatttaccaactgttgagggctctcaagtacattcactctgggatgctactc
catcgggatattaaaccctcaaatatattgctgaattcagagtgccatataaaagtagga
gactttggtttggctaggagtatatccactgatctaagtgaaaataaaattcccgttctg
acggattacgtggctaccaggtggtatagggcaccggaaattctgctcggaagtaccaat
tacacggaaggggttgacatgtggtctcttggctgcatcatgggggagcttctcctcggg
agacctctcttcaggggtaactccacgatgaaccagctagaaaaaatcatccaagtgatt
ggaaagccaacaaagaaagatatggacgatataaagtccccctttacagacacaattata
tcctcctttgttaatattaagaggaagaatttttcagaaatatttgcaaaagcttctgtg
gaggcagttgaccttctgaagcggctcctacagttcaatcccaccaaacggatcagcgcg
gaggacgctctgcggcacaagtacgtcgagcagttccactccattatcgacgagcccgtg
tgcaaacgcatcatcaccatccccgtggacgacggcaccaagtaccgagtcagcttctac
cggaacatcgtctactacgacatcatgcgcaggaagggctgccgcccgggggggggccaa
aaaggggtcgaacgagcggtcgaacgagcggtccaacaagcgggtcaacagacgggccaa
caagcgggtcaacagacgggccaacaagcgggtcaacagacgggccaacaagcgggtcaa
cagacgggccaacaagcgggtcaacagacgggccaacaagcgggtcaacagacgggccaa
caagcgggtcaacagacgggccaacaagcgggtcaacagacggtccaccaatcggttgat
gatgccccttccggtgaggtggcggacacccctctaagtcgctgcgccagcaaggggaag
gcacagtcaaccgcggcgaggatcaccccgcacgaaggaaaatgtgccccaaaaattagg
agcacgcaaagtatacaccaggggggaagcggtggaagtggcggacgcggtgaaagcggc
cgacgtggtgaaagaggccgacgtggtgaaagcggccgacgtggcatacatgacgcagag
accagccgcgataacaaatcggcgaagtgtcagccgaagaggagcagcaaaagggagggc
ccccaggagaggcacaacgggaaggaatgcggccacccgaatgagaaacactactacgag
gttgcttctgaaggcaaagaggtgagaagcgcgcaagtggagagtagggggagtaggacc
aaggcgtttaacggagatgcggcggggaagctccacaaaggggccagtgagaggggaaaa
gccgtcgcgtcagcggcgtccgtcggtgtgaccagaaggaacgatgataagggagggact
acgggggggagaaaggtccacggaaaaactgccagcgtagttagaggagagcacatggtc
aggagcgtggacgggcgcgcagacagtcgagcagtcagacgagcagacagtcgagcagac
atacgagcagacaaactggtgcgaagccacttggtgagcgcggccgacgtggaggcggcg
aaaccgggcccccccagagtgcagcccgccgcgccccagaaggaggaagcggccaagtgg
aggaagcgcggggggggaaaagcgggtgcagcgggtgtagcggcgaggcgcgttgacttt
tgcggcgcccactgccacggcatcacagcaactgcagaaaagaagagcttaaaaaagtga

DBGET integrated database retrieval system