KEGG   Plasmodium vivax: PVX_085730Help
Entry
PVX_085730        CDS       T01073                                 

Definition
ser/thr protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pvx  Plasmodium vivax
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PVX_085730
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PVX_085730
Protein phosphatases and associated proteins [BR:pvx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PVX_085730
Transcription machinery [BR:pvx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PVX_085730
Spliceosome [BR:pvx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PVX_085730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 304 aa AA seqDB search
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC
GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN
MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK
KAAN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatagatatagataatgtaatatcaaagctaatagaagttcgaggcacc
agaccagggaaaaatgttaacttgacagaaaatgagataaaaatattatgcctttccagc
agagaaatttttcttaaccaacctatattactggagcttgaggcaccgataaaaatatgc
ggagacattcacggccagttttacgacctgctaaggctcttcgagtatggcggatttccg
ccggatgccaattatttgtttttgggagattacgtggatagaggtaaacaaagcctagaa
accatttgcttactgctagcgtacaaaataaaatatcctgagaatttttttctactaaga
ggaaatcacgaatgtgcctcgataaacagaatatacgggttttacgatgagtgtaaacga
agatacagtgtaaaattgtggaaaacattcatcgattgcttcaactgtctccccgttgcg
gcaataattgacgaaaaaattttttgtatgcatggcggactgtcgcctgaattaaataat
atggaacagattaggaagataaccaggccaacggatgtacccgacaatggcctcctgtgt
gatttattatggtccgacccggaaaaggaaataaacgggtggggagaaaacgaccgagga
gtttcgttcacgtttggccaggatgtagttcacaattttttaagaaagcatgagttggac
ttgatatgcagagcgcatcaggtggtggaagatggctacgagtttttcgcgaaaagacag
ctagttacgttattttctgctcccaactattgcggagaatttgataatgccggtgcgatg
atgagtgtcgacgagacgttgatgtgttcattccaaattttaaagccagtcgaaaaaaaa
aaggctgctaactga

DBGET integrated database retrieval system