KEGG   Plasmodium vivax: PVX_086230Help
Entry
PVX_086230        CDS       T01073                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pvx  Plasmodium vivax
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pvx00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 117 aa AA seqDB search
MSQIRPEPKVDVPEGDYKKGAKLFKAKCAQCHTINKGGAVKQGPNLYGFYGRKSGESDFP
YSDANKNSGIIWSDKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagataaggccagaaccgaaagtagacgttcctgagggtgactacaaaaagggc
gccaagctttttaaggccaagtgtgcgcaatgccacacgataaataaaggaggagcggtg
aagcagggccctaacctatacgggttttacggcagaaaatctggagaatcggatttccca
tattcggacgcaaataaaaactcgggcattatctggtcggacaagcatttgtatgaatat
ttgctcaaccctaagttgtacatcccaggaacgaaaatgatttttgctggcatcaagaag
gaaaaggaaagagcggatttgattgagtacttgaagaaggcttcctcggagtga

DBGET integrated database retrieval system