KEGG   Plasmodium vivax: PVX_086340Help
Entry
PVX_086340        CDS       T01073                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pvx  Plasmodium vivax
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PVX_086340
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PVX_086340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 441 aa AA seqDB search
MESISRTYENIKNDKNNLSNVENANNGNLKATKNGTVCCPEDLKMYSTIQLNQEIEISKN
PFPLQEINKKNDIPLCAQEFSDLTDPLYIKKICLEKVPEWHHFTEDNLRVKQILSGLTNQ
LFEVGLKEETANNYHSIRRRVLFRIYGKHVDELYNTISEFEVYKTMSKYKIAPQLLNTFS
GGRIEEWLYGDPLRIDDLKNPTILIGIANVLGKFHTLSRKRHLPEHWDRTPCIFKMMEKW
KNQLYKYKNIEKYKRDIHKYIKESEKFIKFMSVYSKSDNLANAIVFCHNDLQENNIINTN
KCLRLIDFEYSGFNFLATDIANFFIETSIDYSVSNYPFFVIDKKKYISYENRKLFITAYL
SNYLDKSLVVPSPKIIDQILEAVEVQALGAHLLWGFWSIIRGYQTKSYNEFDFFLYAEER
FKMYDDQKEYLIANNIIQNYD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtatcagcaggacatatgaaaatattaaaaatgataaaaataatttatcaaat
gttgaaaatgcgaacaatggaaatttgaaagcgaccaaaaatggaaccgtctgttgtcct
gaagacctaaaaatgtatagcactattcagctaaatcaggaaatagaaatatccaaaaat
ccatttcctttacaagaaattaataaaaaaaacgacataccattgtgtgcccaagaattt
tcggatctaacggatccgttatatattaaaaagatatgcctagaaaaggtaccagagtgg
caccattttaccgaagacaatttaagggttaagcagatactaagtggattaaccaaccag
ttatttgaagtgggcctaaaagaagaaacagcaaacaattatcactccataaggaggcgc
gttttatttaggatctatggaaaacacgttgacgagttgtacaatacaatctccgaattt
gaagtgtacaaaactatgagcaaatataaaatagctccccagttgctaaacacatttagt
ggggggcgcatagaggagtggctttatggagatcctctccgaattgatgatttaaaaaac
ccaaccatattaattggtattgcaaatgtgttgggtaaatttcataccctaagtcgaaaa
cgccatctacctgaacactgggatagaacaccgtgtatctttaaaatgatggaaaagtgg
aaaaatcagctctacaaatataaaaatatagaaaaatacaagcgtgatattcataaatat
atcaaagaatctgagaagtttattaaatttatgagtgtgtactccaagtcagacaatttg
gcgaatgctatcgttttctgccataatgacctacaagaaaacaacattattaacaccaat
aagtgtttacgcctaattgattttgaatactctggctttaattttctcgcaacagatata
gccaactttttcatcgaaacatccatagattattctgtaagtaattatcccttttttgta
attgataagaaaaaatacatttcctatgaaaataggaaattgtttatcactgcatattta
tcaaattatctggacaaatctcttgtcgtaccaagccccaaaataattgatcaaatatta
gaggcagtggaggttcaagcgttgggtgcccatttgctatggggattttggtccatcatt
agagggtatcaaaccaaaagttacaacgaatttgattttttcctatacgcagaagagagg
tttaaaatgtatgatgaccaaaaggagtatttaattgcaaacaacattattcaaaattac
gactga

DBGET integrated database retrieval system